KEGG   Leadbetterella byssophila: Lbys_2063Help
Entry
Lbys_2063         CDS       T01350                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lby  Leadbetterella byssophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbys_2063
   01230 Biosynthesis of amino acids
    Lbys_2063
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbys_2063
   00051 Fructose and mannose metabolism
    Lbys_2063
   00562 Inositol phosphate metabolism
    Lbys_2063
Enzymes [BR:lby01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lbys_2063
Exosome [BR:lby04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lbys_2063
  Exosomal proteins of bladder cancer cells
   Lbys_2063
  Exosomal proteins of melanoma cells
   Lbys_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2202731..2203498)
Genome map
AA seq 255 aa AA seqDB search
MRKKYAAGNWKMNKTFEEGQILLSEVVNMVKDELTHPNVQVVLGVPFPYLSTFSKLVDTP
KVALAAQNCYPKASGAYTGEVSVPMLKSVGVKYVIIGHSERREYFAESDAFIAEKVDAIL
AEGLTPIFCCGETLSQREAGIHFDFVKGQLTNSLFHLSEEAIQQVVIAYEPIWAIGTGVT
ASSDQAQEMHKVLRDHLASKYGAAVAEEISILYGGSVNAGNAEELFSQPDVDGGLVGGAS
LKSRDFTDISKSFPA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaatacgcagccggaaactggaaaatgaacaagacttttgaagagggtcaa
attctcctttcagaagtcgtaaacatggtaaaagatgagttgactcatcccaatgtacaa
gtggttttaggggttccatttccttacttgagtacgttttctaagttggttgacaccccc
aaagtggccttggctgctcagaactgttaccctaaagcatccggtgcatataccggagag
gtatccgttcccatgttaaaatctgtaggtgtaaagtatgtgatcattggacactcggaa
agacgggaatactttgccgaatcagatgcctttattgcggagaaagtggatgctatattg
gcggaaggtttgactccaattttttgttgtggagaaaccttaagtcagagggaagcggga
attcattttgactttgttaagggtcagttgacgaatagtttgtttcatctatctgaggag
gctattcaacaggtggtgatcgcctatgaacccatctgggctattggtacaggtgtgacg
gcaagttctgatcaggctcaggagatgcacaaggttttaagagatcatttggcttcaaaa
tacggagctgcagtggcagaagaaatttctatcctttatgggggtagtgtgaatgctggt
aatgcagaagaattattcagtcagccggacgtagacggtgggcttgtaggtggggcgtct
ttgaaatctcgtgattttacagatatatcaaagtccttcccggcataa

DBGET integrated database retrieval system