KEGG   Leadbetterella byssophila: Lbys_2088Help
Entry
Lbys_2088         CDS       T01350                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
lby  Leadbetterella byssophila
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lbys_2088
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Lbys_2088
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Lbys_2088
Enzymes [BR:lby01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Lbys_2088
Exosome [BR:lby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lbys_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2235697..2237091
Genome map
AA seq 464 aa AA seqDB search
MNRRHFFRNSSLALAGTGLIGPQPLFAASAQKAKNIIFLVSDGMSTGTLHMANLYCERTL
GRSSHWIQLYKDRKASRGLMDTQSANSIVTDSAAGSSAFGGGFKVNNGSLNIHPDGRENM
PIWQKFKKAGKKAGIVTSVTATHATPAGFCVTSKSRNAEPEIAEKYLELGIDVVMGGGDE
HFNAEHRKDKKDLYAAYAAKGYEVAKSRDELQKISAKKPLLAIFSSGAIPYAIDRENDPE
LKKTTPSLAEMAKSAIEVLSKHQNGFVLQIEGGKVDWAAHANDIAGLIYDQLAFDEAIKV
AIDFAEKDKNTLVIMTTDHGNANPGTISGGKASEGFDSIRNYKKTNEWLLNQITKDTTAS
QIKDLIHATNGFAPTDEEIKSIKSYYDDIVRGEDGLYNYKKVPFKLYSEIQKKYNYIGWI
SMSHSSDHVEVAAYGPGSELLQPYCMNTDLHYLMLQAAEVPNSF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaagacattttttcagaaatagttccctagccctggccggaaccggacttata
ggccctcaacccctttttgctgcttccgcccaaaaagccaaaaatatcatattcctagtc
agtgatggcatgagtacaggtactctacacatggcaaatctatattgtgagagaacttta
gggagaagtagccattggattcaattatacaaagatcgtaaggccagcagaggcttgatg
gatactcaatctgccaactccattgtgactgactccgcagcgggcagctcagcatttggt
ggaggatttaaagtaaataatggatccctaaacattcatccggatgggcgggaaaacatg
cccatttggcaaaaattcaagaaagctggcaaaaaagcaggcatcgtaacttccgttacc
gctacacacgccacccctgcgggcttctgcgtcactagtaaaagcagaaacgctgaaccg
gaaatcgcagaaaaatatctggaactgggtatagatgtagttatgggaggaggagatgaa
cattttaatgcagaacataggaaagacaaaaaagacctctatgctgcttatgctgcaaaa
ggatatgaggtggcaaagagtagagatgagttacaaaagatctctgcaaaaaaacctctt
ctagctatcttttcttcgggagcaattccctatgccatagaccgagaaaatgaccccgaa
cttaaaaaaactacgccctctttagcggaaatggctaaaagtgccattgaggtcttaagt
aagcatcaaaatggctttgtactacaaatagaaggaggtaaagtggactgggcggcccat
gctaacgatattgcgggtttgatttatgaccaactggcctttgacgaagccatcaaagtg
gccatagactttgcggaaaaagataagaacaccttagtcatcatgaccacagatcatggg
aatgcaaatccaggaaccatttcaggaggaaaagctagcgaaggttttgatagtataaga
aactacaagaaaacgaatgagtggttattgaatcaaatcacaaaagacaccaccgcttca
caaatcaaagacctcatccatgctacgaacggcttcgcacctacggatgaggagatcaag
agtataaaatcctactatgacgatattgtcagaggggaagacggtttgtacaattacaaa
aaagtgccgtttaaactctattcagagattcaaaagaaatacaattatataggctggatc
agtatgagccattcttctgatcatgtggaagtagctgcctatggcccggggagtgaactt
cttcaaccctactgcatgaacacggatctgcattacctcatgctacaggcagcagaagta
cctaattccttctaa

DBGET integrated database retrieval system