KEGG   Leadbetterella byssophila: Lbys_2160Help
Entry
Lbys_2160         CDS       T01350                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lby  Leadbetterella byssophila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lby00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lby00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2339934..2341769
Genome map
AA seq 611 aa AA seqDB search
MIRSILFLLLSFLTLSLKAQDLIPLPVKWEKKTGTFSAKNALDIVVLNPDLRSQAEYLKN
ILPKGNHQILSKPGSKNSIILALSKNDLLGTEGYSLSVKEKEIRITANTSNGIFYGIQTL
RQLLHDGQVSQGEILDYPRFGWRGLMLDVSRHFFTVEEVKKYIDVMSQYKLNVFHWHLTD
DEGWRIEIKSHPKLTEKGAWRVERHGRFGDQRPYPKEGEENTYGGFYTQEQIKDVIRYAA
ERNITIVPEIDLPGHSMALLTAYPELSTKKEPKFVNPGSKFAEWYGAHEFKMLIENTVNP
ADEKVYQVINDIMGEVAALFPGEYIHMGGDEAYHGYWEEDPSVQEFMKKNQLKDTKELQA
YFVRRVNDIIASKGKKMIGWDEILDGGGLPKSTAVMSWRGTSGGIKAAKEGHYVVMSPTT
YAYLDYTQGDKSVENPIYSDLSLARTYELEPVPDGVEPKYILGGQGNLWAEVIPTLNFAF
YMAYPRALAIAEKVWSPKGASDFNGFLKRLDTYFTRFDEAGIPISKAVYEPVVEVKKEGE
KYFLHLKTYWPGAEVYYSLNNTYPVKYSSKYEGPVEIPNGDLKLRTQTIKDGKELGRELI
IPREDLIKRAK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgattcgctctatcctatttctacttcttagtttcctaactctttcactaaaggctcaa
gatctcatccctttacccgttaaatgggaaaagaagacgggcaccttctctgcgaagaat
gccctggatattgttgtcttaaaccccgacctaagaagccaggcagaatacctgaagaat
atcctgcccaaaggaaatcaccagatactatccaaaccagggagtaagaattccattata
cttgctcttagcaaaaatgatctattggggacagaaggatattccctttccgtaaaagaa
aaagagatcagaattacggcaaatacctcaaatggcattttctatggcatccaaaccctt
cgtcaactcttacatgatgggcaagtctcccaaggtgaaatcctggattatccgcgcttc
ggttggagaggtctcatgctggacgtaagcaggcatttcttcaccgtagaggaagtaaag
aaatacattgatgtcatgtctcaatataaacttaatgtattccactggcaccttacagat
gacgaaggctggagaatagagatcaaatcccaccctaaactaacagaaaaaggagcctgg
agggtagaacgtcatggccgcttcggcgatcaaagaccctatccaaaagaaggagaagaa
aatacctacggaggtttctatacccaggaacaaatcaaagatgtgatccgctacgccgca
gaaagaaacatcaccattgtgccggaaatagaccttcctggccattccatggccctactt
accgcctatccggaattatctacgaaaaaggaacctaagttcgtaaacccgggttcgaaa
ttcgcggaatggtacggcgctcacgaattcaagatgctgattgaaaacacagtaaaccct
gcagatgagaaagtctaccaagtcatcaatgacatcatgggcgaagtagccgctctattc
ccgggtgaatatatacatatgggcggagatgaagcctatcatggctactgggaggaagac
ccctcagtgcaggaatttatgaagaagaaccaactaaaagacaccaaagagcttcaagcc
tatttcgtcagaagagtgaatgatatcattgcttccaaaggcaaaaagatgataggctgg
gacgaaatcctggacggtggaggacttcctaagtccaccgctgtgatgagctggagagga
acatccggtggaatcaaagccgccaaagaagggcattatgtagtaatgtcccccaccact
tacgcctatttagactacacccaaggggataaatccgtagaaaatcctatctattcagac
ctttcactcgccagaacgtatgaactagagcccgttccggatggagtggagccaaaatac
atattaggtggacaaggaaatttatgggcagaagtgattccaacccttaacttcgccttc
tacatggcctaccctagggctctggctattgcagagaaggtttggtctccaaaaggagcc
agtgattttaacggatttcttaaacgactagacacctattttacccgctttgacgaagct
ggaattcccatctccaaagccgtctatgagccggtggtagaagtcaagaaagagggcgaa
aagtatttcttgcacctcaagacctattggccaggagcagaagtctattattccttaaat
aatacctatccggtgaagtattcctctaagtatgaaggtcctgtagaaataccaaatggg
gatctaaaactcagaactcagaccataaaagacggaaaagaattaggacgggaactaatc
atacccagagaggacttgattaagagggcaaaataa

DBGET integrated database retrieval system