KEGG   Leadbetterella byssophila: Lbys_2160Help
Entry
Lbys_2160         CDS       T01350                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lby  Leadbetterella byssophila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lbys_2160
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Lbys_2160
Enzymes [BR:lby01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Lbys_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2339934..2341769
Genome map
AA seq 611 aa AA seqDB search
MIRSILFLLLSFLTLSLKAQDLIPLPVKWEKKTGTFSAKNALDIVVLNPDLRSQAEYLKN
ILPKGNHQILSKPGSKNSIILALSKNDLLGTEGYSLSVKEKEIRITANTSNGIFYGIQTL
RQLLHDGQVSQGEILDYPRFGWRGLMLDVSRHFFTVEEVKKYIDVMSQYKLNVFHWHLTD
DEGWRIEIKSHPKLTEKGAWRVERHGRFGDQRPYPKEGEENTYGGFYTQEQIKDVIRYAA
ERNITIVPEIDLPGHSMALLTAYPELSTKKEPKFVNPGSKFAEWYGAHEFKMLIENTVNP
ADEKVYQVINDIMGEVAALFPGEYIHMGGDEAYHGYWEEDPSVQEFMKKNQLKDTKELQA
YFVRRVNDIIASKGKKMIGWDEILDGGGLPKSTAVMSWRGTSGGIKAAKEGHYVVMSPTT
YAYLDYTQGDKSVENPIYSDLSLARTYELEPVPDGVEPKYILGGQGNLWAEVIPTLNFAF
YMAYPRALAIAEKVWSPKGASDFNGFLKRLDTYFTRFDEAGIPISKAVYEPVVEVKKEGE
KYFLHLKTYWPGAEVYYSLNNTYPVKYSSKYEGPVEIPNGDLKLRTQTIKDGKELGRELI
IPREDLIKRAK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgattcgctctatcctatttctacttcttagtttcctaactctttcactaaaggctcaa
gatctcatccctttacccgttaaatgggaaaagaagacgggcaccttctctgcgaagaat
gccctggatattgttgtcttaaaccccgacctaagaagccaggcagaatacctgaagaat
atcctgcccaaaggaaatcaccagatactatccaaaccagggagtaagaattccattata
cttgctcttagcaaaaatgatctattggggacagaaggatattccctttccgtaaaagaa
aaagagatcagaattacggcaaatacctcaaatggcattttctatggcatccaaaccctt
cgtcaactcttacatgatgggcaagtctcccaaggtgaaatcctggattatccgcgcttc
ggttggagaggtctcatgctggacgtaagcaggcatttcttcaccgtagaggaagtaaag
aaatacattgatgtcatgtctcaatataaacttaatgtattccactggcaccttacagat
gacgaaggctggagaatagagatcaaatcccaccctaaactaacagaaaaaggagcctgg
agggtagaacgtcatggccgcttcggcgatcaaagaccctatccaaaagaaggagaagaa
aatacctacggaggtttctatacccaggaacaaatcaaagatgtgatccgctacgccgca
gaaagaaacatcaccattgtgccggaaatagaccttcctggccattccatggccctactt
accgcctatccggaattatctacgaaaaaggaacctaagttcgtaaacccgggttcgaaa
ttcgcggaatggtacggcgctcacgaattcaagatgctgattgaaaacacagtaaaccct
gcagatgagaaagtctaccaagtcatcaatgacatcatgggcgaagtagccgctctattc
ccgggtgaatatatacatatgggcggagatgaagcctatcatggctactgggaggaagac
ccctcagtgcaggaatttatgaagaagaaccaactaaaagacaccaaagagcttcaagcc
tatttcgtcagaagagtgaatgatatcattgcttccaaaggcaaaaagatgataggctgg
gacgaaatcctggacggtggaggacttcctaagtccaccgctgtgatgagctggagagga
acatccggtggaatcaaagccgccaaagaagggcattatgtagtaatgtcccccaccact
tacgcctatttagactacacccaaggggataaatccgtagaaaatcctatctattcagac
ctttcactcgccagaacgtatgaactagagcccgttccggatggagtggagccaaaatac
atattaggtggacaaggaaatttatgggcagaagtgattccaacccttaacttcgccttc
tacatggcctaccctagggctctggctattgcagagaaggtttggtctccaaaaggagcc
agtgattttaacggatttcttaaacgactagacacctattttacccgctttgacgaagct
ggaattcccatctccaaagccgtctatgagccggtggtagaagtcaagaaagagggcgaa
aagtatttcttgcacctcaagacctattggccaggagcagaagtctattattccttaaat
aatacctatccggtgaagtattcctctaagtatgaaggtcctgtagaaataccaaatggg
gatctaaaactcagaactcagaccataaaagacggaaaagaattaggacgggaactaatc
atacccagagaggacttgattaagagggcaaaataa

DBGET integrated database retrieval system