KEGG   Leadbetterella byssophila: Lbys_2254Help
Entry
Lbys_2254         CDS       T01350                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
lby  Leadbetterella byssophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lbys_2254
Enzymes [BR:lby01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Lbys_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2449760..2450710
Genome map
AA seq 316 aa AA seqDB search
MKKSFLFLCLLTTFSAFAQPSRLLAGKGNVYLENGKPAQLRGISFSWSIWGGAKYYNPNV
VDHLIDDFKAKVLRVSMAVEPDQGYLKDPELQWTRIIPVVERCLERGVYVIMDWHDHHAD
KNVETAKEFFEKFSKRYSHSPFIVYEIWNEPERIDWSIIKKYAEEVIPVIRKNDPYNLIV
VGSSTWDQDIDIVAKDPLLGFHNIAYSFHFYASEPHHQEPLRKRATEAIESGLPVFVTEW
GVGEANGDGAFDLEKNKAWMDWMEKYQLSWANWNVTDKKETTALLLPGAPANGKWRNKHL
SPSGKYIREVLRKHAK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcattcctttttctttgcctcctcaccacattttcagcattcgctcagcct
tcccgactcctagcgggcaaaggaaatgtatacttagaaaatggaaaaccagcccaactc
cgaggaataagtttctcgtggagcatttggggaggtgctaaatactataatccaaatgtt
gtagatcatttgattgatgactttaaagctaaagtgcttagggtttctatggctgtagag
ccggatcaaggctatcttaaagatccagaattacaatggacacgtatcatccccgtggtg
gaaagatgtctggaaagaggagtatatgttataatggactggcacgatcatcatgccgac
aagaatgtggaaactgctaaggaattcttcgagaagttctcaaaaaggtactcccactcg
cccttcatcgtctatgaaatatggaatgaaccggaaaggattgattggtcaattataaag
aaatacgcagaagaagtcattcccgtaatccgaaagaatgacccttataatctgatcgta
gtaggttcttccacctgggatcaggacatagatatagtagctaaggacccattacttgga
tttcacaatatcgcatattctttccatttttatgcctcagaaccacatcaccaggagccc
ctaagaaaacgggccacagaggctatagaaagcgggctgccggtattcgttacagaatgg
ggagtaggtgaagcaaatggtgacggagcctttgatctagaaaagaacaaagcctggatg
gactggatggagaagtatcagttgagctgggccaactggaacgtaacggataaaaaagaa
accactgccctattacttccaggcgcccctgctaatggcaaatggaggaacaaacatctc
agcccttccgggaaatatataagagaagttttaaggaagcatgcaaagtaa

DBGET integrated database retrieval system