KEGG   Leadbetterella byssophila: Lbys_2291Help
Entry
Lbys_2291         CDS       T01350                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lby  Leadbetterella byssophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lbys_2291
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Lbys_2291
Exosome [BR:lby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lbys_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2503463..2504950
Genome map
AA seq 495 aa AA seqDB search
MKVIAAIDQGTTSTRCIFVDRKGEIISVGQKEHKQIFPKPGWVEHDPIEIAQNTLEVIAR
ARIQKQIQLNQIVACGITNQRETTVIWNKKTGKPYYNAIVWQDTRVAERADALEKEIGSE
YFRKKTGLPITTYFSSLKIQWLLENVPGLRQDAEEGLALFGNMDTFTVWHLTGGKLHITD
VTNASRTQLMNLETLDWDEEILQKLNIPKSILPEIRSSSEVYGDISAEPLAGVPLAGILG
DQQAALVGQTCFEAGEAKNTYGTGCFMLLNTGTKIVHSKHGLLTTVAYKLGESEVQYALE
GSVAVTGSLVQWVRDNLGIIKESRDIEALAASVEDNGGAYFVPAFSGLYAPYWESSARGI
IAGLTRFVSKGHIARAVLEATAYQTLDVLQAMEKDAGLPLSTLKVDGGMVVNELLMQFQA
DMLEVPVIRPKMIETTALGAAYAAGLATGYWATLEDLKANWGEDKRWNPQMDAQKRLEHQ
KGWKKAIERARNWMD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaatagccgccatagatcaaggcaccaccagcacccgttgtatcttcgtagac
cgaaaaggggagatcatctctgtaggacaaaaggaacacaaacaaatcttcccaaagccg
ggctgggtggaacatgatcccattgaaattgcacagaatacattggaagtcatcgccaga
gccagaatccagaagcagatccaactgaaccaaatcgtagcttgcggaattactaaccag
agggaaaccactgttatttggaacaaaaaaacaggaaaaccatactataatgctatcgtt
tggcaagatactagagtagcagagagagcagatgcccttgagaaggaaattggctcagaa
tacttccgtaaaaaaacaggcctacctatcaccacctatttcagcagcttgaagattcaa
tggctactagaaaatgtgccgggtctacgccaggatgcagaggagggtttagccctcttt
ggtaacatggacaccttcaccgtctggcaccttacaggcggtaaacttcatattacggat
gtaacaaatgcttccaggactcaattgatgaatctggaaacactagattgggacgaggaa
atcctacaaaaactgaatatccccaaaagtattcttccggaaataagatccagctcagag
gtatacggagatatcagtgcggagccattagccggagtacctttagccggaattctggga
gaccaacaagcggcactggtgggtcaaacctgttttgaagctggagaagcaaagaacacc
tatggcacagggtgctttatgcttctaaataccggcacaaaaatagtgcactcaaaacat
ggacttttgaccactgtagcttataaactgggagagtcagaagtacaatatgccctcgaa
ggatccgtggcggtaacaggttccctggttcaatgggtcagagataacctaggtataatt
aaagaaagtagagacattgaagcattagccgctagcgtagaagataatggtggagcatac
tttgtccccgctttctccggtttgtatgccccttactgggaatcctctgctagaggcatc
atagcgggattaacccgatttgtatctaagggacatattgccagagcggttctagaagcc
accgcctatcaaaccctagatgtacttcaagccatggagaaagatgccggtctacctctt
agcaccttaaaagtagatggaggcatggtagtaaatgaattactcatgcagttccaggct
gatatgctggaggttccggtgatcagacccaagatgattgaaaccacggctttaggagca
gcctatgccgcaggtttagctacggggtattgggccactcttgaagatctgaaagccaac
tggggcgaagataaaagatggaatcctcaaatggacgcacagaagcgtttggaacatcag
aagggatggaagaaagccatagaaagagccagaaactggatggattaa

DBGET integrated database retrieval system