KEGG   Leadbetterella byssophila: Lbys_2299Help
Entry
Lbys_2299         CDS       T01350                                 

Definition
udp-N-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lby  Leadbetterella byssophila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lby00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lby00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2510944..2512401
Genome map
AA seq 485 aa AA seqDB search
MLLSDILYNISLITVSGKTDIEIEQITFDSRQVNKGTLFVAVPGTQSDGHDYIETAIDAG
ASAVLCEVLPKMLEEEVTYIQVENSAKSMGIAAGNFYGNPSKRLTLVGVTGTNGKTSVAT
LLFKLFRKLGYKCGLISTVQNQIEDEIIPATHTTPDSITLNALLHEMHQKGCAFVFMEVS
SHSVVQGRISGLHFSGGIFTNITQDHLDFHKTFDEYIKAKKGFFDALPSTAFALTNVDDR
NGKVMLQNTKAEKHSYSLKNIADFKGKVLDCGLFGLQMEIDKQEVWFKLIGQFNAYNLLA
VYGAAVLLEENPENILTELSQLTPPPGRFEQVISSQQTVGIVDYAHTPDALKNVLETING
LRQGHERVITVVGCGGNRDKGKRPLMAGIACELSDTVILTSDNPRFEEPEDILKDMEAGI
PITKQKRVQVIVDRREAIRQAVALAGPEDIILVAGKGHETYQDVKGVKSHFDDREELKLA
FHAQQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgctgctaagtgacatcctctataacatctccctaatcactgtttccggaaaaacagat
atagagattgaacaaatcacctttgactcccgtcaggtaaataaaggtactctctttgta
gcggtacccgggacacaatctgacggccatgattatatagagaccgctatagatgcaggc
gcttctgccgtactgtgtgaagtattacccaaaatgctggaggaagaggtgacttatatc
caggtggaaaattctgctaaatccatgggcatagcagcgggtaatttctatggaaatcct
tctaagagactaactttagtgggagttaccggcaccaatgggaaaacctctgtagccacc
cttctattcaaactattccgtaaactaggttataaatgtggtttgatttctacggtccaa
aatcagatcgaagacgaaatcatcccagctacacatactaccccggactctatcacctta
aacgcactcctacatgaaatgcatcagaaaggctgtgcatttgtctttatggaagtaagc
tcacattcagtagtacaaggtagaatctccggtctacatttctcaggcggtatctttacg
aatatcactcaggatcatttggatttccacaagacctttgatgaatatatcaaagccaaa
aaaggcttctttgatgctctcccttccacggcattcgcacttacaaacgtagatgataga
aacgggaaggtcatgcttcaaaacacaaaagcagagaagcacagctactctctcaagaac
atagcggatttcaaaggtaaggtcctagattgtggacttttcggactacagatggaaatt
gataagcaagaagtttggttcaagcttatcgggcagtttaatgcctataacctccttgct
gtttatggtgccgccgtattacttgaagaaaatcctgagaacattttaactgagctgtcc
caactcacccctcctccgggcaggtttgagcaagtgatttcttctcaacaaaccgtggga
attgtggactatgcacataccccggatgccttaaaaaatgtactagaaaccatcaatgga
cttcgtcaaggacatgaaagagtaattacagtagtagggtgcggaggtaacagggacaaa
ggcaaaagaccacttatggccggaatagcctgcgaactttcagataccgtcattttgact
tcagataatcctagattcgaagaacctgaggatattttgaaagacatggaggcaggcata
cctatcaccaagcaaaaacgcgtacaggttatagtagacagacgagaagccatacgtcag
gccgtagcactggcaggaccagaagatatcattctagtagctggcaaaggacatgaaacg
tatcaagacgttaaaggagttaagtcgcactttgacgatagggaggaattgaagttggct
ttccatgcccaacagtaa

DBGET integrated database retrieval system