KEGG   Leadbetterella byssophila: Lbys_2331Help
Entry
Lbys_2331         CDS       T01350                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
lby  Leadbetterella byssophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2558240..2559319
Genome map
AA seq 359 aa AA seqDB search
MKSKLIPILLLGLGACAQKQEVGLKDVFDYQIGTALSIQQIQEKDRKADSLVKRQFNVLT
PENIMKSMFLQPERGKFDFAAGDQLIQYAEKNGMKVVGHTLVWHSQLPPYAQQIKDKEEF
KAFMEDHIKEVASHYDGKVQGWDVINEALEEDGSLRKSIFLNLLGEDYITDAFKLAAKYT
PSSELYYNDYNIEQPAKRAGAIRLIKKVQDAGLRIDGVGIQGHWMVGKVPFEEIEKSIIE
YAALGLKVMITELDIEVLPRNFTGAEVSKRIEGGENLNPYKDGLPDSVQQQLASDYERLF
QIFEKHKDKITRVTFWGVHDGQSWLNGWPVPGRTNYPLLFDRNYQPKPAYHKVMSLKNK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaaactaattcctatcttgctcctagggctgggagcatgcgcgcagaaacag
gaagtgggcctgaaagatgtcttcgattaccaaatcggtacggctttaagcatccaacaa
attcaagagaaggatcggaaagcagacagtctggtgaagagacaattcaatgtcctcact
ccagagaacatcatgaagagtatgttcttgcagcctgaaagaggtaaatttgactttgcg
gccggagaccaattgatccagtatgctgagaaaaatggaatgaaagtggtaggtcatacc
ctggtttggcatagccaattacccccttacgctcagcaaatcaaagacaaagaggaattc
aaggccttcatggaagaccatatcaaggaggtagcttctcactatgatggcaaagttcag
ggatgggatgtcatcaatgaggcccttgaggaagatggaagccttagaaaatctatcttc
ttaaacctgttaggagaagattatattactgatgccttcaaactagccgctaagtatact
ccgtccagcgaactctattacaacgattacaatattgaacaaccagccaaacgtgcagga
gctattcgtctaatcaaaaaggttcaagacgcaggattaagaatagatggcgtgggtatt
cagggacattggatggtaggaaaagtaccttttgaggaaattgaaaagagcatcatagaa
tatgccgccttaggtcttaaggtcatgatcacggaattagacattgaagttcttcctcga
aatttcaccggtgctgaagtaagcaagcgaatagaaggtggagaaaacctaaacccttac
aaagacggtcttccggatagcgtacagcaacaattagcttctgattacgaacgtttgttc
caaatctttgaaaaacataaggacaaaatcacccgagttaccttctggggagtacatgat
ggtcaaagttggctgaacggttggcccgttccaggcagaacgaactatcctctacttttt
gaccgaaactatcagccaaaacctgcctaccacaaggtgatgtctctaaagaataaataa

DBGET integrated database retrieval system