KEGG   Leadbetterella byssophila: Lbys_2384Help
Entry
Lbys_2384         CDS       T01350                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lby  Leadbetterella byssophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lbys_2384
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbys_2384
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lbys_2384
Enzymes [BR:lby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lbys_2384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2630705..2631883)
Genome map
AA seq 392 aa AA seqDB search
MSKYSVNEKGYYGNFGGAFIPEMLYPNVEELRQNYLRIMETPDFQEEFQRLLIDYVGRPT
PLFLAERLSEKYNTQIFLKREDLNHTGAHKVNNTLGQILLAERLGKKKIVAETGAGQHGV
ATATMCALKGLECIVYMGEIDIERQAPNVARMKMLGAEVRAAKSGSRTLKDATNEAMRHW
INNPTDTHYIIGSVVGPHPYPDMVARFQSVISAEIRKQLLEKTGSELPDYVLACVGGGSN
AAGVFYHFLDQEEVKIVAAEAAGWGVESGKSAATTFLGKPGILHGSKSLLMQTVDGQVVE
PHSISAGLDYPGIGPLHAHLWETKRAEFMAITDKDAMEAGFELAKLEGIIPAIESSHALA
ALKYLPTTPDQKVVVGLSGRGDKDLATYMKWM
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatacagtgtaaatgagaaggggtattatggaaatttcggaggagcttttatc
cctgagatgctataccctaatgtagaagagctgagacaaaattaccttcgtatcatggaa
actcctgactttcaagaggagttccaaagactattaatagactatgtgggtagacctacc
cctcttttcttagcggagcgtttgtcagaaaaatacaatactcagatcttcctaaaaaga
gaagatttgaaccataccggtgcgcataaggtgaataataccttaggtcaaatactactt
gccgaacgactaggtaagaagaagatcgtggccgagaccggagccggtcaacacggcgtg
gctaccgctaccatgtgcgcgctgaaaggcttggaatgcatagtgtatatgggggagatt
gatatcgagcgacaagcaccgaacgtagcgcgtatgaagatgttaggggcggaggttaga
gctgcgaagagcggttcccgtaccctgaaagacgccacaaatgaggccatgcgccattgg
atcaataatcctacagatacacattacatcataggatctgtggtagggcctcatccttat
cctgacatggtggcaaggttccagtcggttatatcagccgagatccgcaagcaattgcta
gagaaaaccggttcagagctccctgattatgtattggcatgtgtgggcggaggatcaaat
gctgcaggagtattctaccatttcttagatcaggaagaagtgaagatagtggcggccgaa
gctgccggatggggggtagaatccggaaaatctgcagccaccactttcttaggcaagccg
ggcatacttcatggaagcaaaagcttattgatgcagacggtagacgggcaagtggtggag
cctcatagcatctctgccggattagattatcccggaataggacctttacatgcgcattta
tgggaaacgaagcgtgcagagttcatggccattacagataaagatgccatggaggccggg
tttgaattagcaaaacttgagggcattattcctgctatagaatccagtcatgccttggca
gcattaaaatatttaccaactacaccggatcaaaaggtagtagtggggctttccggaagg
ggagataaagatttggccacttatatgaaatggatgtga

DBGET integrated database retrieval system