KEGG   Leadbetterella byssophila: Lbys_2505Help
Entry
Lbys_2505         CDS       T01350                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lby  Leadbetterella byssophila
Pathway
lby00010  Glycolysis / Gluconeogenesis
lby00052  Galactose metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbys_2505
   00052 Galactose metabolism
    Lbys_2505
Enzymes [BR:lby01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Lbys_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADQ18168
UniProt: E4RYD2
Position
complement(2760480..2761592)
Genome map
AA seq 370 aa AA seqDB search
MKFKYWLILGVMMACTQKKETANIEKTDFGVLADGSKADLYTLKNANGMEVKITNYGGII
TSWTAPDKDGKYENITLGYSTVEDYEKGSPYFGALIGRYGNRIAGGKFSIDGETYQLPTN
DGPNSLHGGDKGFDKVLWAATPEDGEEPKLKLNYTSKDGEMGYPGTLEVTVTYTLQKDNS
LKIDYEATTDKATVVNLTNHAYFNLAGAQAGSILNHELSMAADRYLPVNATLIPTGELRP
VSGTVFDFTTSTKIGERIEAEDEQLGFGKGYDHCWVFADSSNSLKSVATVFEPTTGRTLE
VLTTEPAIQFYSGNFLTGDYTGKAGEKYPHRSGFCLETQHYPDSPNQSTFPSTLLKPGET
YKSTTIYKFQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaaatattggctaatcttaggtgttatgatggcttgtactcaaaagaaagaa
actgctaacatagagaagacagacttcggtgttttagcagatggttctaaggcggaccta
tacacgttgaagaacgcaaacggtatggaagtaaagatcacgaattatggtggcatcata
acttcttggacagctccggacaaagacggtaaatatgagaatatcacattgggttattct
acggtggaggattatgaaaaaggtagtccatattttggagctttgatcggtagatatggt
aatcgtatagcgggaggtaagttcagtatagacggggaaacatatcagttgcctacgaat
gacggaccaaactcgcttcatggtggagataagggattcgacaaggtgctttgggcggct
acgccagaagatggagaagaacctaaattgaaactgaactatacttctaaggatggtgaa
atgggttatccgggtactttagaggttactgttacttatactttgcaaaaggataattcc
ttgaagatcgattacgaggctactacagataaagctacggtggttaatcttacaaatcat
gcctacttcaatcttgcgggagctcaggcgggaagcatattgaatcatgaattgagcatg
gcggctgatcgttacttaccggtgaatgctactttgattccaaccggagaattgagaccg
gtatcaggaacggtatttgatttcactacatctactaagataggagagaggattgaggca
gaagatgagcaattaggttttggaaagggatatgatcactgttgggtcttcgctgatagc
agtaattcattgaaaagtgtagctacggtatttgagcctactacgggtagaactttggag
gtgctaactactgaacctgccattcagttttattcgggtaacttcttaaccggggattat
actggaaaggcgggcgaaaagtatcctcaccgttcaggattctgtttagagacgcagcat
tatcctgattctcctaatcaatctactttcccgagtacattattaaaaccgggtgagacg
tataaatcgactacgatttataaatttcaatag

DBGET integrated database retrieval system