KEGG   Leadbetterella byssophila: Lbys_2865Help
Entry
Lbys_2865         CDS       T01350                                 

Definition
glycogen(starch) synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
lby  Leadbetterella byssophila
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lbys_2865
Enzymes [BR:lby01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Lbys_2865
Glycosyltransferases [BR:lby01003]
 Polysaccharide
  Storage polysaccharide
   Lbys_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3222798..3224648
Genome map
AA seq 616 aa AA seqDB search
MAGIRLKREQEETVKITKRTTLKPLLFEVAWEVCNQVGGIYTVIRSKVPSMVEEWGENYC
LIGPYFPQTASIEFERIDEDESIFSRVAQNLRNQGIDAFYGRWLVTGNPNIILVDFQQAL
SKIDQLKFDLWANHKISTLNSEPLVSSVIAFGSMVKSYITAFVSAKPKNQECIVHFHEWM
ASSALLDLKKENVNVSTVFTTHATMLGRYIAGNRDDFYEKLSTFNWENEAKFYGIEAQAG
IERLSAQYCNVLTTVSEVTARECEVFYGRTCDLILPNGLNITRFAATHEFQNLHLKYKQK
INQFVMGHFFQSYSWDLDNTLYFFTSGRYEYKNKGYDLTLEALKRLNFKIVQSGLDITVV
MFIITRNPVFSIDPQVLQSRAVMEEIEETCKSIEKEVGEHLFHASASNEDTTMPDLNQFV
SEYWRLRLRRTIQTWKTKTLPRTVTHILKEKDDIVRFFEQTNLQNHQQDRVKFVYHPDFI
SATNPLFGLEYSHFVRGCHLGIFPSYYEPWGYTPLECIVRGIPTVTSDLSGFGDYIQGLM
ADHENMGIYVVNRKDQNFNKAADQLAEILFKFVTLSRRERIMQRNRVENISDIFDWTNLR
SYYDTAHDLALKKRGR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcggggataagattgaaaagagaacaggaagaaaccgtaaaaattacaaaacgtact
accctaaaacctctgctctttgaagtagcttgggaagtgtgtaatcaggtaggagggatc
tataccgtgatccgatccaaagtgccttccatggtggaagaatggggtgaaaattattgc
ctcattggtccgtacttcccacaaaccgccagcattgaattcgaacgcattgatgaggat
gagtccatcttctctcgcgtagcccaaaacctcagaaaccaaggcatagatgccttctac
ggaagatggttggtgaccggaaatcccaatattatcttggtggatttccaacaagcccta
tctaagatcgaccaactcaaattcgacctatgggcgaatcataagatctctaccctgaac
agcgagccgctcgtaagtagtgtcatcgccttcggaagtatggtgaagtcctatatcacg
gcctttgtcagcgctaagccaaagaaccaggagtgcatcgtccacttccacgaatggatg
gcctccagtgcacttcttgacctcaagaaggaaaatgttaacgttagtacggtattcacc
acccatgctaccatgttaggtaggtatatcgccggaaatagagacgacttctacgaaaaa
ctctccactttcaactgggaaaatgaagctaaattctacggtatagaagcccaggcaggc
atcgagcgactatccgcccagtactgcaacgtactcaccacggtttctgaagttaccgcc
agggaatgtgaagtgttctacggtaggacatgtgatctcatactgccaaacggtctgaac
atcacccgttttgccgccacccacgagttccaaaacctgcacctcaagtacaaacagaag
atcaatcagtttgtcatggggcacttcttccagagctactcctgggatctggataatacc
ctgtatttcttcacttccggtagatacgagtataaaaacaagggatatgaccttactctg
gaagccttaaaacgcctcaactttaagattgtacaatccggtctggatatcacggtagtg
atgtttatcatcacccggaatcccgtattctctatagatcctcaggtgcttcaatccaga
gccgtgatggaagagattgaagaaacttgtaagtccatagagaaagaagtgggagaacac
ctcttccatgcatctgcttctaatgaagacaccaccatgccggatctgaaccagttcgta
agtgaatattggagactacgccttcgtagaaccattcagacttggaagactaagaccctc
cctcggacggttacgcatatcctaaaagaaaaagacgatatcgttcgcttcttcgaacaa
actaacctgcagaatcaccagcaagaccgggtgaagtttgtgtatcatcctgacttcatc
tcagccacaaatccattgtttgggctggaatactcacatttcgtgagaggttgtcatttg
ggaatcttcccaagctactacgaaccttggggttacacgcctctggaatgtatagtaaga
ggtatacctacagtgacttctgacctgtcaggtttcggagattatatccagggactcatg
gcagatcatgaaaacatgggaatatacgtggtgaataggaaggatcagaacttcaataag
gccgctgatcaattggcagaaatcttattcaaatttgtcaccttaagtaggagagaaaga
atcatgcagagaaatagagtcgaaaacatctcagacattttcgactggactaatctgcgt
tcttattatgacacggctcatgacctagcgctgaagaaacgcggtcgttaa

DBGET integrated database retrieval system