KEGG   Leadbetterella byssophila: Lbys_2933Help
Entry
Lbys_2933         CDS       T01350                                 

Definition
(p)ppGpp synthetase I SpoT/RelA
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
lby  Leadbetterella byssophila
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lby00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3295810..3298062)
Genome map
AA seq 750 aa AA seqDB search
MSAETVTTEYYSEQEKKEIAKRYRKILRAAKELIKEGDAKMIRKALSVSMEAHKEMRRKS
GEPYIYHPLEVALICVEEIGLGPTSIVCALLHDVVEDTSITLKEIEKDFSPKVAQIIDGL
TKIGGSFEQTQSAQAENFRKMLLTLSTDVRVILIKLADRLHNMRTLDSMAKNSQLKISNE
TIYIYAPLAHRLGLYQIKSELEDLYLKYTHPEDFQDIQNKLSSSKTSRKRLIDNFMKPIK
KRLEEAGLDFYIKGRPKHIYSIWKKLQKSNVPFEGIYDLFAIRIILKGIPADEKEKEKAA
CWQAYSIVTDEYRPNPDRLKDWISTPRANGYESLHTTVMSNAGVWVEVQIRTERMDEIAE
KGYAAHWKYKGNSTSLDKPLDQWINQVRDTLESGDSSAIEFIEDFQSNLYTEEIFIFTPK
GDLKVLRKGATVLDFAFDIHTEIGKKCTAGKVNGTLMPISHVLQSGDQVEILTTKNQKPS
EDWLRFVVTSKAKARIKDLLKESNKGYITEGKDIIAKKLKNLGLENNLETINQLRAYFNK
KDYNDLFYAFGKGHNLPDEISRFKKDKEILANKQKKIELDEKAFKDAKSFEREYKKVQGN
DTLLIGDDMQQIDYTLARCCSPIPGDEVFGFLTINEGIKIHRNSCPNANQLLSNYGNRVI
KARWASQIEKSYLVTIKLNGIDRVGLIQDISKVISNELHINMRGISVETFDGIFEGKIKV
YVFDTKHLDELLHRLEGIEGVSNVSRDEAI
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagaaactgtaactacggaatactactctgaacaggagaaaaaagaaatcgcc
aaacgttatcgtaagatactccgcgcagcaaaagaactgatcaaagaaggagatgccaaa
atgatcagaaaggcattatctgtcagtatggaagctcacaaagagatgagaagaaaatca
ggagaaccttacatctatcatcctttagaagtagctttaatatgcgtggaagaaataggc
ttaggtcctacctctatagtctgcgctttactccatgacgtagtagaagacacctccatc
accttaaaagaaattgagaaagattttagtccgaaggtggctcaaatcatcgatggttta
acgaaaataggtggaagttttgagcaaacccaaagtgcccaggctgagaattttcgtaag
atgttacttaccctttctacagacgtaagggtaatcctgattaagttagctgaccgactc
cataatatgagaaccttagactctatggctaagaactctcagttgaagatatctaacgaa
accatctacatctacgcccctttagctcatagattaggtttgtatcaaatcaaatcagaa
ctggaagacctctacctgaaatatacccatcccgaagattttcaggacatccaaaataaa
ctaagttccagtaagacttccaggaagcgactgattgataacttcatgaagcctatcaaa
aagcgactggaagaagcaggtctagatttttatatcaagggtagaccaaaacacatctac
tccatctggaagaaactccaaaagagtaacgtaccttttgaaggcatttatgacctcttt
gctatccggattatccttaaaggaattcctgcagacgagaaggagaaggaaaaagcggcg
tgttggcaagcttactccattgtcactgatgaataccgccctaaccctgaccgtctgaaa
gactggatatccactcctagagctaacggctacgaatctcttcatactacggtaatgagt
aatgctggggtatgggttgaagtccaaatccgtacggaaagaatggatgagattgcagaa
aaaggttacgcagctcactggaaatacaaaggcaatagcacttctttagacaaacctcta
gatcaatggatcaaccaagttagagataccttagagagtggagattcttctgccatagag
ttcatcgaagacttccaaagtaacctatacacggaggagatctttattttcactccaaaa
ggagacctaaaagttttgagaaaaggggctactgtcctggattttgcttttgatatccac
acagaaataggaaagaaatgtacagccggtaaagttaacggcaccctgatgccaataagc
catgtactacaaagtggagaccaagttgagatcctaactaccaaaaatcaaaaaccttcg
gaagattggttgagatttgtagttacctcaaaagcgaaagccagaattaaggacctttta
aaagagtcaaataaaggatacatcacagaagggaaagacatcatagctaagaagttgaaa
aatctaggcctggaaaataacctggaaaccatcaatcaacttcgggcatacttcaacaag
aaagattacaatgaccttttctatgcatttggtaaaggacataaccttccagatgaaatc
tccagattcaagaaggacaaagaaatccttgctaacaaacagaaaaagattgagctggat
gaaaaagcattcaaggatgccaaaagttttgaaagagaatacaaaaaagttcagggcaat
gacaccttgctgatcggtgatgatatgcagcaaattgactatactctagcacgctgctgt
agtcctatacctggcgatgaagtgttcgggttcttaaccataaacgaagggatcaagatc
catagaaactcttgtccgaacgctaaccagttgctttctaattatgggaaccgtgtaatc
aaggcgcgttgggcaagtcagattgagaaatcttatctggtaaccatcaaattaaatggt
atagaccgggtaggtttaattcaggatatctctaaagtgatctcaaatgagctacacatc
aacatgagaggtatctctgtagaaacttttgatggtatatttgaaggaaaaattaaagtt
tacgtatttgacactaaacacctggatgaattgctgcatcgcctagaaggcatcgaagga
gtaagcaatgtttcaagggacgaagcgatataa

DBGET integrated database retrieval system