KEGG   Leadbetterella byssophila: Lbys_2938Help
Entry
Lbys_2938         CDS       T01350                                 

Definition
rok family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lby  Leadbetterella byssophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbys_2938
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbys_2938
   00052 Galactose metabolism
    Lbys_2938
   00500 Starch and sucrose metabolism
    Lbys_2938
   00520 Amino sugar and nucleotide sugar metabolism
    Lbys_2938
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lbys_2938
   00524 Butirosin and neomycin biosynthesis
    Lbys_2938
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lbys_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3301996..3302904
Genome map
AA seq 302 aa AA seqDB search
MATEYLGIDIGGTNVKMGIVDATNGNIKNFYSHETSSWRASGHFVERLGDAIVLQLKENP
DVKKVGIGVPGLISRDRNTLIEITAIPETNGIHIIPVLKERFPDHEFFLENDANAAALGE
YYFGEEKLPEDYIFVTLGTGVGGAAIIDKQVFKGGGGNAMEPGHMPSENGKVLERIIGKN
ELLDMANEMRAAFEGETKLPADGTISTTGLVAAASEGDELALQIFDRVGGLLGDGLVSMI
RILDITTVLIGGGLSASFDYILPAIQRQLKYWLTPYYVKTLDIRRATLANDAGLLGAASL
CF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggaatacctggggatagacattggcggaacaaacgtgaaaatgggcatagta
gacgccaccaacggtaatattaagaatttttatagtcacgaaaccagttcatggcgtgct
tccgggcactttgtagagcgattaggagatgctatagttctgcagctaaaggaaaatcct
gatgttaagaaagtggggatcggtgttcctggtttaatttcaagagatcgaaataccttg
attgaaattaccgctattcctgagaccaatggtattcatattattcctgttttaaaggag
agatttccagatcatgaattcttcctggaaaatgatgcaaatgctgcagctttaggtgaa
tattattttggagaagagaaactaccggaagattatatttttgtgaccttaggcacaggg
gtaggcggtgcagccattattgataagcaagtattcaaaggaggtggcggaaacgctatg
gagccgggtcatatgccttctgagaacggaaaagttttggaaaggatcattggcaagaat
gagcttttagatatggctaatgagatgcgtgcagcatttgaaggtgaaacaaaacttcct
gctgacggtaccatttctaccacgggattagtggcagctgcttcggaaggagacgagctt
gctttacagatctttgaccgggtaggtggtctgcttggtgatggtctagtgagcatgata
cgtatattagatattactacggtacttattggaggcggtttgtcagcttcctttgattat
atattacccgctattcagcgtcaattgaagtattggttaactccttattacgtaaaaact
ttagatattcggagagctacattagcaaatgacgcgggacttttaggcgcggctagctta
tgcttctaa

DBGET integrated database retrieval system