KEGG   Leadbetterella byssophila: Lbys_2943Help
Entry
Lbys_2943         CDS       T01350                                 

Definition
d-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lby  Leadbetterella byssophila
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Lbys_2943
   00051 Fructose and mannose metabolism
    Lbys_2943
Enzymes [BR:lby01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Lbys_2943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3306619..3307950
Genome map
AA seq 443 aa AA seqDB search
MAIVTGDTEYFKGIGEIKYEGKDTDNPLAFRYYDPNRIVRGKTMKEHLKFAGAYWHSFNG
NGSDPFGEPTHIFPWDVKQDPIVRAKDKMDAAFEFLTKMNLPYYCFHDVDMVDYGSDVAE
NERRLEALTQYALEKQKATGVKLLWGTANLFSNRRYMNGAITNPDFHVLTHGAAQVKAAL
DATIQLGGENYVFWGGREGYMTLLNTDMKREKEHFARFLHTVRDYARKNGFTGTFFIEPK
PCEPSKHQYDYDAETVIGFLRQYDLLSDFKLNLEVNHATLAGHTFQHELQVAADAGLLGS
IDANRGDYQNGWDTDQFPNNINELVESMLIILEAGGFKGGGINFDAKIRRNSTDQEDLFY
AHIGGMDIFAKALLLADEILEKSEYSKLKANRYASFDSGLGKAFEEGKLSLEDLRNYAAE
NGEPKVISGKQEYLENLINRYIF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctattgtaacaggagatacagagtacttcaagggtattggtgagattaaatatgag
ggaaaggatacagataaccctttggccttccgctactatgatccaaatagaatagtaaga
ggaaaaaccatgaaggaacatttgaaatttgccggggcctattggcactcattcaatggc
aatggttcagatccttttggtgaacctacgcatattttcccttgggatgtaaagcaagat
cccatagtgagagctaaagataagatggatgctgcgtttgagtttttgaccaaaatgaat
ctgccttattactgcttccatgatgtagatatggtagattatggttcagatgttgccgaa
aatgaaaggcgattagaggctctaactcaatatgccctggagaaacaaaaggctacaggc
gtgaagttgctttggggaacagcaaaccttttctcgaataggagatacatgaatggagcc
ataactaatccggattttcatgttcttacgcacggagcagcacaagtgaaagcggcctta
gacgctactatccagttaggcggagaaaattatgtattctggggaggtagagaaggctat
atgactcttttgaatacagacatgaagagagagaaagagcattttgcccgtttcttacat
actgttagagattatgccagaaagaatggatttacaggtaccttcttcatagaacctaag
ccatgtgagccttcaaaacatcaatatgattatgatgcggagacggtgataggattcttg
agacagtatgatctattatccgactttaaacttaaccttgaagttaaccacgctactcta
gcaggacataccttccagcatgaattacaggtggctgctgatgccggtctactaggctct
atagatgctaacagaggagattatcagaacggttgggatacggatcaattccctaataac
atcaatgagcttgttgaatccatgttgatcatattggaagcaggtggcttcaaagggggt
ggaatcaattttgatgcgaagattagaagaaattctacggatcaagaggatcttttttat
gcacatatcggaggaatggatatatttgcaaaagctctgcttttagcagatgaaattttg
gaaaaatctgaatattccaaattaaaggcaaaccgttatgcatcttttgattctggacta
ggaaaagccttcgaagaaggaaaattaagtctggaagatttaagaaattatgcagcagaa
aatggtgagcctaaggtcatcagcgggaagcaggaatacttagagaatttaattaatcga
tatattttctaa

DBGET integrated database retrieval system