KEGG   Leadbetterella byssophila: Lbys_3134Help
Entry
Lbys_3134         CDS       T01350                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lby  Leadbetterella byssophila
Pathway
lby00010  Glycolysis / Gluconeogenesis
lby00620  Pyruvate metabolism
lby00640  Propanoate metabolism
lby00680  Methane metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbys_3134
   00620 Pyruvate metabolism
    Lbys_3134
   00640 Propanoate metabolism
    Lbys_3134
  Energy metabolism
   00680 Methane metabolism
    Lbys_3134
Enzymes [BR:lby01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Lbys_3134
Lipid biosynthesis proteins [BR:lby01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Lbys_3134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADQ18795
UniProt: E4RV57
Position
complement(3538071..3539969)
Genome map
AA seq 632 aa AA seqDB search
MRIKTIEEYHQAYQESVKDPETFWAGIAQEFQWKKPWTKVLDWNFEDYQVKWFRNGKLNI
TENCLDRHAASKPNHPAIIWEPNDPEDEPEIITYKILLDRVCRFANVLKKHGVSKGDRVC
IYMPMIPELAVAVLACARIGAIHSVIFGGFSAHSISDRINDSQCELVITTDGSIRGSKHI
PMKDTVDDALIACPTVKKVIVATHTRTPVSMIKGRDFWWESEIKKVEAECPAEEMDAEDP
LFILYTSGSTGKPKGVVHTCGGYMVYTSYTFENVFQYNPGDVFFCTADVGWITGHSYLVY
GPLLSGAISVMFEGVPTYPDAGRLWDIVARHKVNILYTAPTAIRSLMGFGLEYVQDKDLS
SLKVLGSVGEPINEEAWYWYHEHIGKGKCPIVDTWWQTETGGIMISPLAGITPTKPSFAT
LPLPGVQLALVDENGTVIEGNSVSGNLCITFPWPSIIRTTWGDHERCKSTYFSTYPGRYF
TGDGCLRDKDGYYRITGRVDDVINVSGHRIGTAEVENAINSHTGVVESAVVGYPHDVKGQ
GVHAFVILEEDQEANSMMKRDILMTVSRIIGPIAKPDKIQFVKGLPKTRSGKIMRRILRK
IAEGEFNSLGDTSTLLDPSVVEEIVEGSKNLD
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgcgaataaaaaccatagaagaataccatcaagcttatcaggagagtgtaaaggatccg
gagaccttttgggcaggaatagcgcaggagttccagtggaaaaaaccatggactaaggta
ctggattggaattttgaggattaccaagttaaatggtttcgaaatggtaagctgaacatc
acagagaactgcttagacagacatgcagcttctaaacctaatcatcccgctatcatctgg
gagcctaatgacccggaagacgaaccggaaattattacctacaaaatcctattagacagg
gtttgcagattcgctaacgtactgaagaaacacggagtaagtaagggcgatagggtatgt
atctatatgcccatgatccctgaattagctgtagctgtacttgcctgcgccagaataggc
gccatacattccgtgatctttgggggcttctctgctcactctatatcagatcgtatcaat
gattctcaatgtgaattagtcatcaccacagacggatccatccgtggatcaaaacatatc
cctatgaaggatacggtggatgacgccctgatagcttgccctacagtgaagaaggtgatc
gtggctacacatacgcgtactcctgtatccatgatcaaagggcgtgacttctggtgggaa
tcagaaatcaagaaagttgaagcggaatgtcctgccgaagaaatggacgcagaagatcca
ttatttatcctttatacttcaggctccaccggcaaaccaaaaggagtagtgcatacctgt
ggaggctacatggtttacacctcatacacctttgaaaacgtgttccaatataatccaggt
gatgtattcttctgtaccgctgacgtaggctggattacaggacactcctatctggtttat
ggacctttactttctggggctatttccgtgatgtttgaaggggtccctacttacccagac
gcgggtagactttgggatatcgttgctcgtcacaaagtaaatattctatatactgctcct
acggctatacgctctttgatgggattcggcttagaatatgttcaagacaaagaccttagt
tctcttaaagttctaggtagcgtaggcgaacctatcaacgaagaagcgtggtactggtac
catgaacatataggaaaaggaaaatgccccatagtagatacctggtggcaaacagaaacc
ggtgggatcatgatctctcctcttgcaggtatcactcccactaaaccctcttttgctact
ctgcctttacctggggtacaattagcccttgtggatgagaacggaaccgtcattgaaggg
aatagcgtgagtggaaacctgtgtataaccttcccatggccatccataattagaaccact
tggggagatcacgaaagatgcaagagtacctacttctccacctatcctggaaggtatttc
acgggcgacggttgcctccgcgacaaagacggatattaccgcattacaggtagggtagac
gatgtcatcaatgtaagcggtcataggataggcaccgcagaggttgaaaatgctatcaat
agtcatactggagtggtagaatccgcggtagtgggttatcctcacgacgtgaaaggacaa
ggggtacacgccttcgtcatcctcgaagaagatcaggaagctaactctatgatgaaaaga
gacatcttaatgaccgtctcgagaatcattggaccaatagcaaaaccggataagattcaa
tttgtaaaaggacttcctaagaccagatccggaaaaattatgcgaagaatccttcgaaaa
atagcagagggagagttcaatagtttaggagacacctccaccctactagacccaagtgtg
gttgaagaaatagtggaaggttccaaaaatctagattaa

DBGET integrated database retrieval system