KEGG   Leadbetterella byssophila: Lbys_3174Help
Entry
Lbys_3174         CDS       T01350                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lby  Leadbetterella byssophila
Pathway
lby00330  Arginine and proline metabolism
lby00332  Carbapenem biosynthesis
lby01100  Metabolic pathways
lby01130  Biosynthesis of antibiotics
lby01230  Biosynthesis of amino acids
Module
lby_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lbys_3174
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Lbys_3174
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lbys_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADQ18835
UniProt: E4RV97
Position
complement(3577096..3578121)
Genome map
AA seq 341 aa AA seqDB search
MKKDILVIKFGTASLGNGEPDVQILKEIARQIAQLHKKHYLVIVSSGAVGAGKSFIPRYE
ATIAQKKAAAAIGNPLLLKMYQEVFAEYNIVVAQSLIEKQHFSQRPQFLQLKETYEELWK
SDIIPIANENDVVSNRELKFSDNDELATLIASGFGAKKLMLCTASGGLLDPSGQIIPEVE
RIDEKILSYVLPSKTSLGSGGMASKLTFTHLANKMGIEVVIFGMKETDGILKAFRGESGT
TFRAYPTKINARNKWLASSGISVGKVSIDKGAEDALKARKSLLHVGIKNYTGEFTKGELV
EIQNEAGETIGVGKVRISSVDIPNSAGKNTLIIHADDLVVW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagacatacttgtcatcaagtttggtacagcatccctcgggaacggagaacct
gatgtacagatattaaaagaaatagcaagacaaattgcacaacttcataaaaagcattac
ctcgttatagtatcctcaggggcagtaggtgcgggaaaatcatttatacctcgctacgaa
gctactatcgcgcaaaaaaaagctgcggccgctatagggaaccccttgctactaaaaatg
tatcaggaggtatttgcagagtataatattgtagtggcacaaagtttaattgagaagcaa
cacttttctcaaaggccacaatttcttcagctaaaagaaacctacgaagaattatggaag
tcagacatcattcctatagcgaatgaaaatgacgtagtaagtaacagagaattaaagttc
tctgataacgacgagttagctactttaatagccagcggatttggggcaaagaaactaatg
ctttgtactgcctccggtggtctattggacccttccggtcaaataattccagaagtcgaa
cgaatagacgaaaaaattctttcctacgtccttccttcaaagacatccctaggttcaggg
ggcatggcatctaaactgacctttactcatttggcaaataaaatggggattgaagtagtg
atctttggaatgaaagaaacagatggtatcctaaaagcttttagaggagaaagtggaact
actttccgagcataccctactaagatcaatgcgcgaaataaatggcttgcaagctccgga
atctcagtaggcaaggtaagtatagacaaaggtgcagaagatgccttgaaagcccgcaaa
agcttattacacgtaggtattaaaaactacacaggagaattcaccaaaggtgaactggta
gagatccaaaatgaagctggagaaacgattggtgtaggaaaggtcaggatatcctcagtg
gatattccaaattctgcagggaaaaataccctcatcatccatgcagatgatttagtggtc
tggtaa

DBGET integrated database retrieval system