KEGG   Leadbetterella byssophila: Lbys_3489Help
Entry
Lbys_3489         CDS       T01350                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lby  Leadbetterella byssophila
Pathway
lby00020  Citrate cycle (TCA cycle)
lby00310  Lysine degradation
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
Module
lby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lbys_3489
  Amino acid metabolism
   00310 Lysine degradation
    Lbys_3489
Enzymes [BR:lby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Lbys_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADQ19137
UniProt: E4RYK7
Position
3934621..3936099
Genome map
AA seq 492 aa AA seqDB search
MAIEMKVPSVGESVTEVTIASWVKKDGDLVKMDEVICELESDKATFELPAEADGILRIVG
KEGDTLAIGEVICIIEPSSAAPVKEESAPAAAPVENVPTQTIEITVPAVGESITEVTVSN
WIKKSGDTVGLDEIICELESDKATFELPSPQAGVLEVVAQEGDVVAIGGVLAKLTTGGTT
AAAVAAPAPVAAAPANDNYAAGHPSPAAAKVLAEKGISPDAVQGTGVGGRITKEDANNAS
KPATPAPSKEELVKEAPKGDRISRREKMSSLRKTIAKRLVAVKSETAMLTTFNEVDMKPI
MDLRKQYKDKFKEVHGVGLGFMSFFTKACSIALQEFPVVNAFIDGDEIVYNDFTDISIAV
SAPRGLVVPVIRNAEKMSFSDIEAEVVRLATKARDNKLTIEEMTGGTFTITNGGIFGSMM
STPIINAPQSAILGMHNIVERPVAINGQVEIRPMMYVALSYDHRTIDGRDSVGFLVRVKQ
LLEDPMRMLLQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatgaaagtgccctccgttggcgaatccgtaacggaagtgactatcgca
tcctgggtaaagaaagacggagacctggttaaaatggacgaggtgatctgtgagttagag
tctgataaagcaacatttgagctacctgctgaagcagatggcatattaagaatagtaggt
aaagaaggagatacattagctattggtgaggttatatgcatcatagaaccttcttctgca
gcaccggtgaaagaagagtcagctccggctgccgcaccggtggaaaatgtacctacacaa
actattgaaattaccgttcctgccgtaggtgagtctatcacagaagtaaccgtttctaat
tggattaagaaaagtggtgatactgtgggcctagatgaaatcatctgcgaattggaatct
gacaaggctacttttgaactaccttctcctcaagccggagtattagaggtagtagctcaa
gaaggtgatgtagtagcgataggtggagtattagctaaattaactacagggggaactaca
gcagcagccgtagcagctcctgctcctgttgcagcagcacctgcaaatgataactatgca
gccggacatccttctccagcagctgctaaagtattagcagaaaaaggaatctctcctgat
gccgttcaaggtacaggagtaggaggtagaatcaccaaagaagatgctaacaatgcttct
aagccagcaactcctgccccttctaaagaggaattagtgaaagaagcacctaagggtgat
agaatctccagaagagagaaaatgagttctctaagaaaaactatagctaagagattagta
gcggttaagtctgagacagctatgttaactacattcaatgaagttgacatgaagcccatc
atggatcttagaaagcaatacaaagacaagttcaaagaagtgcacggagtgggacttgga
ttcatgtccttcttcacaaaagcttgttctatagcactacaagaattccctgtggtgaac
gctttcattgatggagatgaaatagtatacaatgactttacagatatctctattgcggta
tctgcaccaagaggtttggtagttccggtgattcgcaacgctgaaaaaatgtccttcagt
gatattgaagcagaggtagtacgtttggctacaaaagctagagataacaagttgaccata
gaagagatgaccggtggtacctttactataactaacggtggtatcttcggatccatgatg
tctactcctatcatcaacgctcctcaatctgctattttaggtatgcacaatatagtggaa
agacctgtagcgattaacggacaagttgaaattcgtccaatgatgtacgtggctctgtct
tatgaccatagaaccattgacggtagagattccgtaggattcttagttagagtaaaacaa
ttgttggaagatcctatgaggatgcttcttcaggtataa

DBGET integrated database retrieval system