KEGG   Leadbetterella byssophila: Lbys_3489Help
Entry
Lbys_3489         CDS       T01350                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lby  Leadbetterella byssophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbys_3489
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lbys_3489
  Amino acid metabolism
   00310 Lysine degradation
    Lbys_3489
Enzymes [BR:lby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Lbys_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3934621..3936099
Genome map
AA seq 492 aa AA seqDB search
MAIEMKVPSVGESVTEVTIASWVKKDGDLVKMDEVICELESDKATFELPAEADGILRIVG
KEGDTLAIGEVICIIEPSSAAPVKEESAPAAAPVENVPTQTIEITVPAVGESITEVTVSN
WIKKSGDTVGLDEIICELESDKATFELPSPQAGVLEVVAQEGDVVAIGGVLAKLTTGGTT
AAAVAAPAPVAAAPANDNYAAGHPSPAAAKVLAEKGISPDAVQGTGVGGRITKEDANNAS
KPATPAPSKEELVKEAPKGDRISRREKMSSLRKTIAKRLVAVKSETAMLTTFNEVDMKPI
MDLRKQYKDKFKEVHGVGLGFMSFFTKACSIALQEFPVVNAFIDGDEIVYNDFTDISIAV
SAPRGLVVPVIRNAEKMSFSDIEAEVVRLATKARDNKLTIEEMTGGTFTITNGGIFGSMM
STPIINAPQSAILGMHNIVERPVAINGQVEIRPMMYVALSYDHRTIDGRDSVGFLVRVKQ
LLEDPMRMLLQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatgaaagtgccctccgttggcgaatccgtaacggaagtgactatcgca
tcctgggtaaagaaagacggagacctggttaaaatggacgaggtgatctgtgagttagag
tctgataaagcaacatttgagctacctgctgaagcagatggcatattaagaatagtaggt
aaagaaggagatacattagctattggtgaggttatatgcatcatagaaccttcttctgca
gcaccggtgaaagaagagtcagctccggctgccgcaccggtggaaaatgtacctacacaa
actattgaaattaccgttcctgccgtaggtgagtctatcacagaagtaaccgtttctaat
tggattaagaaaagtggtgatactgtgggcctagatgaaatcatctgcgaattggaatct
gacaaggctacttttgaactaccttctcctcaagccggagtattagaggtagtagctcaa
gaaggtgatgtagtagcgataggtggagtattagctaaattaactacagggggaactaca
gcagcagccgtagcagctcctgctcctgttgcagcagcacctgcaaatgataactatgca
gccggacatccttctccagcagctgctaaagtattagcagaaaaaggaatctctcctgat
gccgttcaaggtacaggagtaggaggtagaatcaccaaagaagatgctaacaatgcttct
aagccagcaactcctgccccttctaaagaggaattagtgaaagaagcacctaagggtgat
agaatctccagaagagagaaaatgagttctctaagaaaaactatagctaagagattagta
gcggttaagtctgagacagctatgttaactacattcaatgaagttgacatgaagcccatc
atggatcttagaaagcaatacaaagacaagttcaaagaagtgcacggagtgggacttgga
ttcatgtccttcttcacaaaagcttgttctatagcactacaagaattccctgtggtgaac
gctttcattgatggagatgaaatagtatacaatgactttacagatatctctattgcggta
tctgcaccaagaggtttggtagttccggtgattcgcaacgctgaaaaaatgtccttcagt
gatattgaagcagaggtagtacgtttggctacaaaagctagagataacaagttgaccata
gaagagatgaccggtggtacctttactataactaacggtggtatcttcggatccatgatg
tctactcctatcatcaacgctcctcaatctgctattttaggtatgcacaatatagtggaa
agacctgtagcgattaacggacaagttgaaattcgtccaatgatgtacgtggctctgtct
tatgaccatagaaccattgacggtagagattccgtaggattcttagttagagtaaaacaa
ttgttggaagatcctatgaggatgcttcttcaggtataa

DBGET integrated database retrieval system