KEGG   Leadbetterella byssophila: Lbys_3489Help
Entry
Lbys_3489         CDS       T01350                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lby  Leadbetterella byssophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbys_3489
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lbys_3489
  Amino acid metabolism
   00310 Lysine degradation
    Lbys_3489
Enzymes [BR:lby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Lbys_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3934621..3936099
Genome map
AA seq 492 aa AA seqDB search
MAIEMKVPSVGESVTEVTIASWVKKDGDLVKMDEVICELESDKATFELPAEADGILRIVG
KEGDTLAIGEVICIIEPSSAAPVKEESAPAAAPVENVPTQTIEITVPAVGESITEVTVSN
WIKKSGDTVGLDEIICELESDKATFELPSPQAGVLEVVAQEGDVVAIGGVLAKLTTGGTT
AAAVAAPAPVAAAPANDNYAAGHPSPAAAKVLAEKGISPDAVQGTGVGGRITKEDANNAS
KPATPAPSKEELVKEAPKGDRISRREKMSSLRKTIAKRLVAVKSETAMLTTFNEVDMKPI
MDLRKQYKDKFKEVHGVGLGFMSFFTKACSIALQEFPVVNAFIDGDEIVYNDFTDISIAV
SAPRGLVVPVIRNAEKMSFSDIEAEVVRLATKARDNKLTIEEMTGGTFTITNGGIFGSMM
STPIINAPQSAILGMHNIVERPVAINGQVEIRPMMYVALSYDHRTIDGRDSVGFLVRVKQ
LLEDPMRMLLQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatgaaagtgccctccgttggcgaatccgtaacggaagtgactatcgca
tcctgggtaaagaaagacggagacctggttaaaatggacgaggtgatctgtgagttagag
tctgataaagcaacatttgagctacctgctgaagcagatggcatattaagaatagtaggt
aaagaaggagatacattagctattggtgaggttatatgcatcatagaaccttcttctgca
gcaccggtgaaagaagagtcagctccggctgccgcaccggtggaaaatgtacctacacaa
actattgaaattaccgttcctgccgtaggtgagtctatcacagaagtaaccgtttctaat
tggattaagaaaagtggtgatactgtgggcctagatgaaatcatctgcgaattggaatct
gacaaggctacttttgaactaccttctcctcaagccggagtattagaggtagtagctcaa
gaaggtgatgtagtagcgataggtggagtattagctaaattaactacagggggaactaca
gcagcagccgtagcagctcctgctcctgttgcagcagcacctgcaaatgataactatgca
gccggacatccttctccagcagctgctaaagtattagcagaaaaaggaatctctcctgat
gccgttcaaggtacaggagtaggaggtagaatcaccaaagaagatgctaacaatgcttct
aagccagcaactcctgccccttctaaagaggaattagtgaaagaagcacctaagggtgat
agaatctccagaagagagaaaatgagttctctaagaaaaactatagctaagagattagta
gcggttaagtctgagacagctatgttaactacattcaatgaagttgacatgaagcccatc
atggatcttagaaagcaatacaaagacaagttcaaagaagtgcacggagtgggacttgga
ttcatgtccttcttcacaaaagcttgttctatagcactacaagaattccctgtggtgaac
gctttcattgatggagatgaaatagtatacaatgactttacagatatctctattgcggta
tctgcaccaagaggtttggtagttccggtgattcgcaacgctgaaaaaatgtccttcagt
gatattgaagcagaggtagtacgtttggctacaaaagctagagataacaagttgaccata
gaagagatgaccggtggtacctttactataactaacggtggtatcttcggatccatgatg
tctactcctatcatcaacgctcctcaatctgctattttaggtatgcacaatatagtggaa
agacctgtagcgattaacggacaagttgaaattcgtccaatgatgtacgtggctctgtct
tatgaccatagaaccattgacggtagagattccgtaggattcttagttagagtaaaacaa
ttgttggaagatcctatgaggatgcttcttcaggtataa

DBGET integrated database retrieval system