KEGG   Leadbetterella byssophila: Lbys_3580Help
Entry
Lbys_3580         CDS       T01350                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lby  Leadbetterella byssophila
Pathway
lby00020  Citrate cycle (TCA cycle)
lby00310  Lysine degradation
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
Module
lby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lbys_3580
  Amino acid metabolism
   00310 Lysine degradation
    Lbys_3580
Enzymes [BR:lby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Lbys_3580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ADQ19228
UniProt: E4RZT6
Position
complement(4024524..4025726)
Genome map
AA seq 400 aa AA seqDB search
MAKIEILMPNMGESIFECTVLKWLVKEGDRVETDDMIIEVATDKIDTEIGSSHTGVITKF
LVQEGDIAKIGSPICEIEVEGASKPEPYKAAALELETQIQQTVAAVAPSTDNRFYSPLVL
SIAKEENISMDELEKIQGTGQNQRVTKDDILAYVKTRKITTPQFTSSSEDQIVEMDRMRK
MIAQRMVDSKRISPHVTSFIETDVTQLSSWRNKVKDEFKIKYNENLTFTPLLIRAIVAAI
KKYPAINAQVDGDKIIYKKDINIGMAVALPNGNLIVPVIHHADQYSLIQLSSKVNDLATR
ARNNQLKPEELVGGTYTMSNIGGFGNLAGTPIILQPQVAIMAFGVIRKMPAVIETEEGDF
IGIRQKMIISHSYDHRVVDGSLGGLFLKEVSDYLESEQNL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatagagattttaatgcctaacatgggcgaaagtatctttgaatgcaccgta
cttaagtggttagtgaaagaaggcgacagggtagaaactgacgacatgatcattgaggta
gccacggataaaattgacacagaaattggctcctcacataccggagtgatcacaaaattc
ttggtgcaggaaggagatattgcaaaaataggcagtcccatttgcgaaatagaagttgaa
ggggcttctaaacctgaaccatataaagctgctgctttagaattagaaactcagatccaa
cagaccgtagctgcagtagctccatctactgataatagattctattcccctttggtactt
agcattgctaaagaagaaaatatcagtatggatgaactggaaaaaatccagggaaccgga
caaaatcaaagagtaaccaaagatgacattctcgcctatgtgaagacgagaaagataacc
actcctcaattcacctcttcatcggaagatcaaatcgtggagatggacagaatgcgcaag
atgattgcccaaagaatggtagattctaagcgcatttcccctcatgtcacctcatttata
gaaactgacgttactcagctatcttcttggaggaataaagttaaagatgagttcaaaatt
aagtacaacgaaaacttaacatttacaccccttctaattcgtgctattgtcgcagctatc
aagaaataccctgcgataaatgcgcaggttgacggtgacaagatcatctataaaaaggat
atcaacataggaatggcagttgccttacctaacggaaacctgattgtgccggttattcac
cacgccgaccaatacagtttaatccaattatcttccaaagtcaatgatttggctactcgt
gccagaaacaatcaactgaaaccggaggaattagtaggtggaacttacaccatgtctaat
atcggcggatttggaaacctggcaggtacccctatcatccttcaacctcaggtagccatc
atggcgttcggagttattcgtaagatgccagcggtaattgagacggaggaaggagacttt
attggaataagacagaagatgattatctcacattcctatgaccaccgtgtggtagacgga
tctctgggaggccttttcctcaaagaggtttctgattatctggaaagtgaacaaaacctg
taa

DBGET integrated database retrieval system