KEGG   Leadbetterella byssophila: Lbys_3586Help
Entry
Lbys_3586         CDS       T01350                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lby  Leadbetterella byssophila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lby01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lby00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4031074..4032336
Genome map
AA seq 420 aa AA seqDB search
MEIFKYPNEEEIQRIIRRPVLDTAEIEKKVEPILLAVQKEGDYALRRFALEFDNVMMDDF
SVSKETVEEAIQNLDPALKNAIDYAYENIKKFHEVQLKVEDPVETRPGVKCWRKSVGIEK
VGIYIPGGTAPLFSTVLMLGIPAQLAGCKEVVLCSPASHPAIYYCAQKCGVTKIFKVGGA
QAIAAMAFGTESIPQVSKIFGPGNQFVTAAKQAVTRYGIAIDMPAGPSEVAVLADETANP
SFIAADLLSQAEHGVDSQVVLVTTSEAILAQVKAEVELQVSLLPRKDMADGALSHSRLVV
VKDKEEAMSLSNRYAPEHLILAISDPLEWADKVLNAGSVFLGHYTPESCGDYASGTNHTL
PTNGFAKAYSGVSVDSFVKKITFQEISREGLENIGPHVMQMAKAEALEAHSFAVQVRLEA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggagatttttaaatatccgaacgaagaagagatccaaagaatcattcgtaggccggta
ttagacactgcagagattgaaaagaaagtagagcctatactgctagccgtccaaaaggaa
ggagattatgctttaaggaggtttgctctggagttcgataatgtgatgatggatgatttc
tccgtaagtaaagagacggttgaagaggccattcaaaacttggatcccgcacttaaaaac
gctatcgattatgcctatgagaatatcaagaaattccatgaggtacaattgaaggtggaa
gatccggtggaaactcgcccgggtgtgaagtgttggaggaagtcagtaggcatagagaaa
gtgggaatctatattcccggtggtaccgcccctctcttttccactgttttaatgttgggt
attccagctcaattagccggatgtaaagaggtagttttatgttctcctgcatcacatcca
gccatttattattgtgcgcaaaaatgtggggtgacaaagatcttcaaggtaggaggggca
caggccattgcagccatggcttttggaacggaaagtatacctcaggtttctaagattttt
ggcccaggtaaccaattcgttactgcagccaaacaagccgttactcgctacggaatagct
atagatatgcctgctgggccatctgaagtagctgtgctggctgatgaaaccgctaatcca
agttttatagctgcagaccttttgtcgcaagcagagcacggtgtagattctcaggtagtg
ctggttactacttcggaagctattctggctcaagtaaaggcggaggtggaactacaagta
tctttactccctcgtaaagacatggcagatggtgctttaagccactcccgactagtagta
gtgaaggacaaagaagaggctatgagtctctcgaatagatacgctcctgaacatttgatc
ctggcaataagtgatccattagaatgggcagataaggtgcttaatgcgggttcagtgttt
ctaggtcattatactccggaatcttgcggagattatgcttcaggcaccaatcataccttg
ccaactaacggtttcgccaaagcctatagtggggtctctgtagacagttttgtaaaaaag
attactttccaggagattagcagggaaggtttagaaaatataggaccgcacgtcatgcaa
atggctaaagcggaggctctggaggcccatagttttgccgtgcaggttagattagaagca
taa

DBGET integrated database retrieval system