KEGG   Leadbetterella byssophila: Lbys_3586Help
Entry
Lbys_3586         CDS       T01350                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lby  Leadbetterella byssophila
Pathway
lby00340  Histidine metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01230  Biosynthesis of amino acids
Module
lby_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Lbys_3586
Enzymes [BR:lby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Lbys_3586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh SIP
Motif
Other DBs
NCBI-ProteinID: ADQ19234
UniProt: E4RZU2
Position
4031074..4032336
Genome map
AA seq 420 aa AA seqDB search
MEIFKYPNEEEIQRIIRRPVLDTAEIEKKVEPILLAVQKEGDYALRRFALEFDNVMMDDF
SVSKETVEEAIQNLDPALKNAIDYAYENIKKFHEVQLKVEDPVETRPGVKCWRKSVGIEK
VGIYIPGGTAPLFSTVLMLGIPAQLAGCKEVVLCSPASHPAIYYCAQKCGVTKIFKVGGA
QAIAAMAFGTESIPQVSKIFGPGNQFVTAAKQAVTRYGIAIDMPAGPSEVAVLADETANP
SFIAADLLSQAEHGVDSQVVLVTTSEAILAQVKAEVELQVSLLPRKDMADGALSHSRLVV
VKDKEEAMSLSNRYAPEHLILAISDPLEWADKVLNAGSVFLGHYTPESCGDYASGTNHTL
PTNGFAKAYSGVSVDSFVKKITFQEISREGLENIGPHVMQMAKAEALEAHSFAVQVRLEA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggagatttttaaatatccgaacgaagaagagatccaaagaatcattcgtaggccggta
ttagacactgcagagattgaaaagaaagtagagcctatactgctagccgtccaaaaggaa
ggagattatgctttaaggaggtttgctctggagttcgataatgtgatgatggatgatttc
tccgtaagtaaagagacggttgaagaggccattcaaaacttggatcccgcacttaaaaac
gctatcgattatgcctatgagaatatcaagaaattccatgaggtacaattgaaggtggaa
gatccggtggaaactcgcccgggtgtgaagtgttggaggaagtcagtaggcatagagaaa
gtgggaatctatattcccggtggtaccgcccctctcttttccactgttttaatgttgggt
attccagctcaattagccggatgtaaagaggtagttttatgttctcctgcatcacatcca
gccatttattattgtgcgcaaaaatgtggggtgacaaagatcttcaaggtaggaggggca
caggccattgcagccatggcttttggaacggaaagtatacctcaggtttctaagattttt
ggcccaggtaaccaattcgttactgcagccaaacaagccgttactcgctacggaatagct
atagatatgcctgctgggccatctgaagtagctgtgctggctgatgaaaccgctaatcca
agttttatagctgcagaccttttgtcgcaagcagagcacggtgtagattctcaggtagtg
ctggttactacttcggaagctattctggctcaagtaaaggcggaggtggaactacaagta
tctttactccctcgtaaagacatggcagatggtgctttaagccactcccgactagtagta
gtgaaggacaaagaagaggctatgagtctctcgaatagatacgctcctgaacatttgatc
ctggcaataagtgatccattagaatgggcagataaggtgcttaatgcgggttcagtgttt
ctaggtcattatactccggaatcttgcggagattatgcttcaggcaccaatcataccttg
ccaactaacggtttcgccaaagcctatagtggggtctctgtagacagttttgtaaaaaag
attactttccaggagattagcagggaaggtttagaaaatataggaccgcacgtcatgcaa
atggctaaagcggaggctctggaggcccatagttttgccgtgcaggttagattagaagca
taa

DBGET integrated database retrieval system