KEGG   Leishmania braziliensis: LBRM_01_0360Help
Entry
LBRM_01_0360      CDS       T01113                                 

Definition
putative poly(A) export protein
Orthology
K14298  
mRNA export factor
Organism
lbz  Leishmania braziliensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LBRM_01_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:93780..94520
Genome map
AA seq 246 aa AA seqDB search
MWDLNSSQKAVVASHDLPISCLDFLTLPQTMSQVLITGSWDGKLRWWDLRQQNFVREDNL
GEPVFALDAQKTVPMLAAATGRLAHVYDVQQMQKVNELKLPDVMKFNLRCITCAPQYDGV
GVGSSEGRVSFLNLKDGQGCTFKAHIISEKSHYILNQTNFCVHHPTLPILLSGGGDGNLT
LINRVDRKIVKTLHCEQKVGTQAIPISAGDISVDGSLVAYAHSYDWAMGKSGYKNQPTSV
HIRPLS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtgggacctgaattcgagtcaaaaggcggtcgttgcgtcacatgatttgccaattagc
tgtctcgattttctgactcttccacagacgatgagccaggtgcttatcaccgggagctgg
gacggcaagttgcgttggtgggacctgaggcagcagaactttgtgagggaagataacttg
ggggagcctgtgttcgctctcgatgcacagaaaacagttccaatgttggctgctgcaaca
ggtcgacttgctcatgtttatgacgtgcaacagatgcagaaggtcaacgaactcaaactc
cccgacgttatgaaatttaatctccgctgcatcacgtgcgccccacagtacgacggagtc
ggagtcggttcctcagaggggcgagtctccttcctcaacttgaaagatggtcaagggtgc
acattcaaggcgcacatcattagcgaaaagtcccactatattctaaatcagaccaatttt
tgtgtgcaccaccctacgctgccaattctcctgtccggtggaggcgatggtaatttgacg
ctcatcaaccgtgtcgatcgcaaaatcgtcaaaacacttcactgcgagcaaaaagtaggc
actcaagcgatcccaatatcggctggcgacatcagcgtggatggatctcttgttgcctat
gcgcatagctatgattgggctatgggtaagagtggctacaaaaaccaaccaacctcagtg
cacattcggccgttgtcgtga

DBGET integrated database retrieval system