KEGG   Leishmania braziliensis: LBRM_06_0830Help
Entry
LBRM_06_0830      CDS       T01113                                 

Definition
dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
lbz  Leishmania braziliensis
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LBRM_06_0830
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LBRM_06_0830
   00670 One carbon pool by folate
    LBRM_06_0830
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LBRM_06_0830
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     LBRM_06_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:356269..357834
Genome map
AA seq 521 aa AA seqDB search
MSRAAARFKIPMSVTKDSFAFPSLRCFSIIVAVDEQHGIGDGKTIPWQVPEDMAFFKDQT
TLLRNKKPPTEKKRNAVVMGRQTWESVPLKYRPLKGRLNVVLSSKATVDELLAALPEGKR
TAAAQDLVVVNGGLAEALHLLARPPHCSSIETAYCVGGAQVYSDAMTAPCVEKLQEVYLT
RIYATAPECTRFYPFPPTNAAAAAWDLAWTQGRQRSETGGVEYEIRKYVPHNHEERQYLE
LIDRIMKTGIAKEDRTGVGILSLFGAQMRFSLRDNRLPLLTTKRVFWRGVCEELLWFLRG
ETNAQLLADKDIHIWDGNGSREFLDSRGLTANKEMDLGPVYGFQWRHFGAQYKGFEANYD
GEGVDQIKSIVETIKVNPNDRRLLLTAWNPCALHEMALPPCHLLAQFYVNTDAKELSCML
YQRSCDMGLGVPFNIASYALLTILMAKATGLRPGELVHTLGDAHVYRNHIDALKVQLERT
PNAFPTLVFKREREFLEDYELSDMEVIDYAPYPPIKMEMAV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggcagctgcgaggtttaagatcccgatgtcggtgacgaaggacagctttgcc
ttcccctcccttcgctgcttctccatcattgtcgccgttgatgagcagcacggcatcggc
gacggaaagacaatcccgtggcaggtgccggaggacatggcgttcttcaaagaccaaacc
acgctgctacgcaacaagaaaccgccgacggagaagaagcgcaacgccgtcgtgatgggt
cgccagacgtgggaaagcgttccgctcaagtaccggccactcaagggtcggctgaacgtg
gtgctttcctcgaaggccaccgtggacgagcttctggcggcactgccggagggaaagcgg
accgcagcggcgcaggatctggtggtggtgaacggcggactcgccgaggcactccatctc
ctcgcacggccgccgcactgcagctccattgaaacagcgtactgcgtcggtggcgcgcag
gtttactccgacgccatgacggcgccgtgcgtcgagaagctgcaggaggtgtacctgacc
cgcatctacgcgacggcgccggagtgtacgcgcttctacccgttcccgcccacaaacgcc
gccgccgccgcgtgggacctggcatggactcagggacgccagcggagcgagactggcggt
gtcgagtacgagatccgaaaatacgtgccacacaaccacgaggagcggcagtacctcgaa
ctgattgaccgcatcatgaagactggtattgcgaaggaggaccgcaccggagtgggcatt
ctcagcctcttcggcgcgcagatgcgcttctccttgcgagacaaccgcctgccgctcttg
acaacgaagcgtgttttctggcgcggcgtgtgcgaggagctgctgtggttcctgcgcggc
gaaacaaacgcccagttgctggcggacaaggacattcacatctgggatggtaacggctcg
cgcgagtttctcgacagccgcggcttgacggcgaataaggagatggatctcggccctgtc
tacggattccagtggcgccacttcggagcacagtacaaggggtttgaggcgaattacgat
ggcgaaggggtggaccagatcaaatccatcgtggagaccatcaaggtgaacccaaacgac
cgccgcctcctgttaactgcctggaacccatgcgcgctgcacgagatggcgttgccgccc
tgtcacttgcttgctcagttctacgtgaacacggacgcgaaggagctgtcctgcatgctg
taccagcgctcgtgcgacatggggctcggcgtccccttcaacatcgcctcctacgcgctg
ctcaccatccttatggcaaaagccacgggtctgcggcctggcgaactcgtgcacacgctc
ggcgacgcccatgtctatcgcaaccacatcgatgctctgaaagtgcagctcgagcgaacc
ccgaacgccttcccgaccctcgtgttcaagagggaacgggagttcctggaggactacgag
ttgtcagacatggaggtgatcgactacgcgccatacccgcctattaagatggagatggcc
gtatag

DBGET integrated database retrieval system