KEGG   Leishmania braziliensis: LBRM_07_0810Help
Entry
LBRM_07_0810      CDS       T01113                                 

Definition
malonyl-coa decarboxylase-like protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
lbz  Leishmania braziliensis
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lbz00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:lbz00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:lbz04146]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:346060..348045
Genome map
AA seq 661 aa AA seqDB search
MAEVALTQLRRAIHSDQGRIPGVIVESVWAAFDVLVPPVVQDSATNDNITSATEDNFFLF
ISTLNELNFDLDAVVRASARLAAKVDTYLTLLRQAEAQETQRAAAATASGTAQAACDEGE
PTELMKAKGEVMQCCFEARNAGSPLYYTWLWHTAAMPDGLRRLMHFRKLTHFFESLCKRH
IKNLTPPPPRSLSSLAPVTDESVASPSAAAAASSTERDRCAGELSKWHRRLVEVGLIGRA
MSLLFHDFFSKEYLVMEELTWPSTPPSMLDQIMRAESVHPFVRGLEDMRHRLQPAHHRHL
FAFLHPAVVDEPLIAVQVALTHGITSSVDQILGRPTPLSDPANMSQAALYFRDVPQSSST
VDCAGAADDDNVNTAIFYSINSAQSALRGMDMGNRLIKRVVQEVKGNINARRQARSLTPI
NTFCTLSPIPLYVKWLADEVAALAATDATVTTATATTSGIFGRQLSPAEEETRCWEPLRE
AVLSYVLRHPDVLPTEGRAMMRATESSRGNPAAVNTAVLQYLVCLLQSACAASSLSHDES
APFGSGSTPTQRHQQPWWMDHTFTMALETPLLRSVATYLCTAKRSHDGRILDPVGNFHVS
NGATVYRLNFLANTTPQASRESACVMVNYWYDLPRVLANAAQYEVSRTVSLGEPIKALLG
N
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggtggcactgacccagctgcgccgcgccatccacagcgatcaaggacgcatt
cccggcgtcattgtggagagcgtgtgggccgccttcgatgtgctcgtgccgcccgtcgtt
caggacagcgccacgaatgacaacatcacatccgcgacggaggataacttctttctgttt
atctcgaccctcaacgagctcaactttgacctggacgccgtggtgagggcgagcgcgcgg
ctggcggcgaaggtggacacctacctgacgctgctaaggcaggcagaggcacaggaaaca
cagcgcgcggcagcagcgactgcctctggcactgcacaggccgcttgcgatgaaggtgaa
cccacagagctcatgaaggctaagggagaggtcatgcagtgctgcttcgaggcccgcaat
gccggctctcctctgtattacacgtggttgtggcacacagccgccatgccagatggcctg
cgacggctcatgcactttcgaaagctgacccacttcttcgagagcttgtgcaagcgacac
atcaagaatctcacgccgccgccgccacgctcgttgtcctcgttggcgcctgtcactgac
gagtctgtggcgtcaccgtcagcagcagctgcagcgagctccacggagagggaccgctgc
gccggcgagctctccaagtggcatcgtcgtcttgtcgaggtgggtctcatcggtagggcc
atgtcgcttcttttccacgacttcttctccaaggagtacttggtgatggaggagctgacg
tggccctcgacgccgccgtcgatgctggaccagatcatgcgtgccgagtctgtccacccc
ttcgtccgcggactcgaagacatgcgccatcgccttcagccggctcaccaccgccacttg
tttgcctttctacaccccgccgtcgtcgatgagccgcttatcgccgtgcaggtagcgctg
acgcacggcattaccagctctgtggaccagatcttaggtcgccctacgccgctgtcagac
ccggcgaacatgtcgcaggcggctctctacttccgcgatgtgccgcaatcctcctccacg
gtggactgcgccggtgcggcggatgacgacaacgtgaacactgccatcttctacagtatc
aactctgcgcagagtgcgttgcgcggcatggacatgggcaatcgtctcatcaagcgcgtc
gtgcaggaagtgaagggcaacatcaacgccaggcggcaggcgcgcagcttgacgccaatc
aacaccttctgcactctctcacccatcccgctctatgtcaagtggctggctgatgaggtg
gccgcgctggcggccaccgatgcgacagtgaccacagcaacagcgacgacaagcggcatc
tttggcaggcagctttccccagcggaggaagagacgcgctgctgggagccgcttcgcgag
gccgttctcagctacgtcctgcggcaccctgatgtgctacccacggaggggcgtgcgatg
atgagggcgaccgaaagcagtcgcggcaaccccgcagccgttaacacagcggtactgcag
tatctcgtatgtctccttcagagcgcatgtgccgcctcctcgttgtcgcatgatgaaagt
gccccgtttggctcgggcagcaccccaacgcagcggcatcagcagccatggtggatggac
cataccttcacaatggccctcgagaccccactgttgcgctccgtcgccacgtacctgtgc
accgccaagcgtagccatgatggccgcattctcgacccagtcggcaactttcacgtgtcg
aacggcgccaccgtttatcggttgaacttcctcgcgaacacgaccccacaagccagtcgt
gagagtgcctgcgtcatggtgaactactggtacgacctgccaagggtgttagccaacgcc
gcgcagtacgaggtgagtcgcaccgtgtctcttggcgagccaatcaaggcgctgctgggg
aactga

DBGET integrated database retrieval system