KEGG   Leishmania braziliensis: LBRM_09_0240Help
Entry
LBRM_09_0240      CDS       T01113                                 

Definition
putative ubiqitin hydrolase
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
lbz  Leishmania braziliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:83291..86041
Genome map
AA seq 916 aa AA seqDB search
MSSTTSSRGQPRHELLKEEPMISFEVGLDEAIELPCDVGTVAPTGAALSSLHWRKQTVTP
VARTTPEDMTTQSGSSTASLRAAVCGNGMGLPNTTMTTGGVTSPVATSANTAATTYMAAA
PSRKVTWKDTSASQRRAEAQASREDDFNPMVLCPLQNLGNTCYFNAGVQLLVNCPALVYA
VRNSPFARRMQSHSAFNVYNVSVPVATVAAAATAKLYPKGGVATHALFQEFAALLARMEV
GCSAGERAISPIRALDSLASVHPQFEGRSQQDASEMMTSLLTSLEEEGGQYVELAQLLQS
FEEDAAALQQDAPAARFVTTVNPPFSGAGPSSPSEQHQRYYSDPYSVDEYPLSSRHPSRT
DAILPGPRSAHFLAVLRLMEQVNRENEVLEQRVKHRQGKPYTGSFKPPRLHFNPLLDSFR
GYTLSQVECHNCRAVSRVVSAFNGLMLDVPTAKQRRRYAMAHPNVPRRADWEEQLQHVKK
PFRLSWWNPFSLCAAAWQHLKRLLQDPFPLPLWLDECLDIHFEPELLRGCNKYRCETCGT
TSEATKSETLLALPEYLLIHMKRFEVGRFFNSKKTDSVFFPASWRSLTEAQAAALLNGRS
ETRSPLPEYLDLRRYLHSSVAPFAEPIPPCLLNTVTEPYQQQHASESRTRSPTSSIATTY
TLDGIVNHHGGYDSGHYTVFLYKATEERQAWVYISDDEVVQAEDVVATDTEYVLLYRRQP
LVQVAPESDEAEQLRRKACYYLSSSSSPYLTAYAAANVASPAISKSHSTTSASSYLTDSA
AGGLPSATAVATAPWVYISRMWLQRVAFMHDPGPIVNRLCYCRPEDQGRVSMYQTIFPAT
VKVPAEVPHVHGPPVDWFYVPITEKDYAIFYNAFGGNVAVTANEYETLRAMQEKFCADID
AAERQRSGAARRASQR
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctacgacgtcgtcgcgggggcagccgcgccacgagctgctcaaggaagagccg
atgatctcctttgaagtgggactcgacgaggcgatcgagctgccgtgcgacgtgggcacc
gtcgcaccgacaggcgccgcgctgagctcactacattggcgtaaacagaccgtaacgccg
gttgcaaggaccactccagaggacatgacgacgcagagtggtagcagcaccgcgagcctc
agagccgccgtgtgcggcaacggcatggggctccccaacactaccatgaccactggcggc
gtcacctctcccgtcgccacgtcggccaacacagctgccacgacctacatggcggcggcg
ccgtcgcgaaaggtaacgtggaaagacaccagtgcgtctcagcggcgtgcagaggcgcag
gcaagccgcgaagatgatttcaacccgatggtactatgcccgcttcagaacctgggcaac
acgtgctacttcaacgcgggtgtgcagctgctcgtgaattgccctgctctcgtctacgca
gttcgtaactcaccgtttgcgcggaggatgcaaagccactcggccttcaacgtctacaac
gtatcagtaccggtggcgacggtggctgcagcggcaacggcgaagctgtacccgaaaggg
ggtgtcgccacccacgcactcttccaggagtttgctgccctgctcgcccgcatggaggtg
ggatgctcagccggtgagagggcgatctcgcccatccgtgcgctcgactccctcgccagc
gtgcatccgcagtttgagggtagaagccagcaagatgcatcagagatgatgacgtcgctg
ctgaccagcttggaggaggaaggcggccagtacgtcgagctggctcagctcctgcagtcg
tttgaagaggacgccgcggcactgcagcaggacgcgccagcagcgaggtttgtcacgact
gtcaacccgcctttttcgggagctgggccctcatctccctcagagcagcaccagcgctac
tacagcgatccctacagtgtcgatgagtaccccctgtcgtcgcggcacccctctagaaca
gacgccatcctcccgggtccgcgcagcgcgcacttcctcgctgttttgcgactgatggag
caggtgaatcgtgagaatgaggtacttgagcagcgtgtgaagcaccggcaaggcaagccc
tacactggctctttcaagccgccgcgactacacttcaacccgctgctggacagtttccgg
gggtacacactatcgcaggtggagtgccacaactgccgcgcagtgtcgcgcgtggtgagc
gccttcaacgggttgatgctggatgtgccgacagcaaagcagcgacggcgctatgcgatg
gctcacccgaacgtgccgcgccgcgctgactgggaggagcaactgcagcacgtgaagaag
ccctttcgtctgagctggtggaatcccttctccctgtgcgcggcggcgtggcagcacctg
aagcggctcctccaggacccgttcccgctcccgctgtggctggacgagtgcctcgatatt
catttcgagccggagttgctgcgcgggtgtaacaagtaccgctgcgagacctgcggcacc
accagcgaagccaccaagtcggaaacactcctggccctacccgaatacttgctcatccac
atgaagcgcttcgaagtcggccgcttcttcaacagcaagaagacggactcggtttttttc
cctgcctcatggcggtctctgacggaagcgcaggcagcggcgttgctcaacgggagaagc
gagacgcggtcaccgctgccggagtacctcgacctgcggcgctacctgcacagcagcgtc
gcaccgttcgctgagcccatcccaccctgcctgttgaacaccgttaccgagccctaccaa
cagcagcacgcgagcgaaagccgtaccagaagccccaccagctccatcgcaaccacctac
acgctagacggcattgtcaaccaccacggcggctacgacagcggccattacaccgtcttc
ctctacaaagcgacggaggagcggcaggcgtgggtgtacattagcgacgatgaggttgtg
caggcggaggatgtggtggcgacagacaccgagtacgtcctgttataccgccgtcaaccc
ctcgtgcaggtggcaccagagtcggacgaggcggaacagctgcgccgaaaggcgtgctac
tacctctcttcctcctcctctccctaccttaccgcctacgcagcagcaaacgtggcaagc
ccagcgatcagcaagtcacatagcacgacctccgcctcttcctacttgacggactccgcg
gctggcgggctaccttccgcgacagcagtggcgaccgccccgtgggtgtacatctcgcgc
atgtggcttcagcgcgtcgccttcatgcatgacccgggcccgattgtgaatcgtctgtgc
tactgccgcccagaggatcaggggcgggtgagcatgtatcagaccatctttccagcgaca
gtgaaggtgccggcggaggtgccccacgtccacggcccgccggtggactggttctacgtg
cccatcacagagaaggactacgccattttctacaacgcgtttggcggcaacgtagccgta
acggccaacgaatacgagaccctgcgcgcgatgcaggagaagttctgcgctgacatcgac
gcagcggagcggcagcgaagcggcgcagctcgccgtgcttcccagcgctga

DBGET integrated database retrieval system