KEGG   Leishmania braziliensis: LBRM_11_0330Help
Entry
LBRM_11_0330      CDS       T01113                                 

Definition
stearic acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lbz  Leishmania braziliensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lbz01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lbz01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:141012..142394
Genome map
AA seq 460 aa AA seqDB search
MLAAVQSLFTCSVLPADVAKPKEEREVPQWTKGNFQYNWIGIYIIGVPTLFVLLGLYLHI
PLSPSLLQWLIFFGVVTGMVGVTSGYHRLFSHGAFTGGQAMQWTCAFVGAGAFQGSIKWW
ARNHRVHHKYTDTCKDPYNAHRGFFFTHFGWFVMRMDYELLGDADVSDLKDNLVVEFQRK
YFAVIATITGILIPLVVAGATTGEWLGAFFWVVWLKIFLVHQFSFLINSLAHTRFFGATR
PYSDDLTPHDSTLLAIINLGEGYHNFHHQFPNDYRNGHLWHHIDVTKWYIFLCSFLGFCD
NLQRAPRAVIDRAAAMQAVRTHERGLVEAANEVRRLEVPATVEYTWDDVRAEVRQGRKLI
VMDGYVLDIEQPIPVDPAWAQTDKINWMNTHPGGRALLLAYVGKDATAAFNGGVYGHTMG
ARNYLPELRVGCIKEPPVPAASGKTVSGAGRLGVVKYTTA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggccgtacagagtctcttcacctgcagcgtccttcctgcggatgtggcaaag
cccaaggaggagcgtgaggtaccccagtggacaaagggcaactttcagtacaactggatc
ggcatctacatcatcggcgtgccaacgctgtttgtgctgcttggcctgtacctgcacatc
ccgctatccccctcgcttctgcagtggcttatattctttggtgttgtcactggaatggtg
ggggtgacgtccggctatcatcgcctcttctcccacggagctttcaccggcgggcaggca
atgcagtggacgtgcgccttcgtgggtgctggggcgttccagggttccatcaagtggtgg
gctcgaaatcaccgcgtccaccacaagtatacggatacctgcaaggacccctacaacgcg
catcgtggcttcttcttcacgcacttcggctggttcgtcatgcgcatggactacgagctg
ctcggcgacgcggatgtgtcggacctgaaggacaaccttgtcgtggagtttcagcgcaag
tactttgccgttatcgctaccatcacagggatcctgatccccctcgtagtggctggcgca
accactggggagtggttgggtgcgtttttctgggtggtgtggctcaagatcttcctcgtg
caccagttctctttcttaatcaacagcctcgcgcacacgcgcttctttggcgccacgcgg
ccgtactcggatgacttgaccccgcacgactccaccctcttagcgatcatcaacctcggc
gagggctaccacaactttcaccaccaattcccgaacgactaccgcaacggtcatctgtgg
caccacattgacgtaacgaagtggtacatctttctctgcagctttctgggcttttgcgat
aacttacagcgggccccgcgcgccgtgatcgaccgcgccgccgcgatgcaggctgtgcga
acgcacgagcgcgggttggtggaagcagcgaatgaggtgaggcggctggaggtgccagcg
accgtggagtacacgtgggacgacgtacgcgcggaggtgagacagggccgcaagctgatt
gtgatggacggctacgtgctggatattgagcagccaatccccgtggaccctgcgtgggcg
cagacggacaagatcaactggatgaacacgcaccctggtggacgtgcgctgctgcttgca
tatgtgggcaaggacgcgacggccgccttcaacggtggcgtgtacggccatacgatgggg
gcgcgcaactacctgccggagctgcgcgtgggttgcataaaggagcccccggtgcccgca
gcgtctggcaagacggtgagtggcgctggtcgcttgggggtggtgaaatatactaccgca
taa

DBGET integrated database retrieval system