KEGG   Leishmania braziliensis: LBRM_13_0880Help
Entry
LBRM_13_0880      CDS       T01113                                 

Definition
putative NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lbz  Leishmania braziliensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LBRM_13_0880
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LBRM_13_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:complement(317413..318339)
Genome map
AA seq 308 aa AA seqDB search
MIYLLVIIAVNMAAFFAFMYKRMAKVAMDPTMFKHFKLIKRTEVTHDTFIFRFALENETQ
SLGLPIGQHIVLRADCTTSGKTETVTHSYTPISSDDEKGYVDFMIKVYFAGVHPSFPHGG
RLSQHLYHMKLGDKIEMRGPQGKFTYLGNGTSRIQKPGQGFITDKVDAYAAIAGGTGITP
ILQIIHAIKKNKEDRTKVFLVYGNQTERDILLRKELDEAAANDDRFHVWYTVDREVTPEW
KFDVGYVREEMFRRHLPVPDMLGDDSVPQNAGIKKVMALMCGPPPMVQMAIKPNLERIGY
TADSMFNF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccttctcgtcatcatcgctgtcaacatggcagccttcttcgcgttcatgtat
aagcgcatggcgaaggtagccatggacccgacgatgttcaagcattttaagctgatcaag
cgcaccgaggtgacccacgacaccttcatcttccgcttcgccctagagaacgagacgcag
tcgctcgggctgccgattgggcagcacattgtgctccgtgccgactgcacgacgtctggg
aagacggagacggtgacgcactcctacacacccatctccagcgatgacgagaaaggctac
gtggacttcatgatcaaggtgtactttgctggcgtgcaccccagcttcccgcatggcggc
aggctgtcgcagcacctgtaccacatgaagcttggtgacaagatagagatgcgtggaccg
caggggaagtttacctacctgggcaacggcacctcgcgcatccaaaaaccaggccagggc
ttcatcacagacaaggtggacgcctatgcggccatcgctggcggcactggcatcaccccg
atactgcagatcatccacgccatcaagaagaacaaggaggaccgcacaaaggtgtttctc
gtgtacggcaaccagacagagcgtgacatcctgctgcgcaaggagcttgacgaggctgcc
gccaacgacgaccgctttcacgtgtggtacaccgtcgaccgtgaggtaactccagagtgg
aaatttgatgtggggtacgtccgagaggagatgttccgcaggcacttgcccgtccctgac
atgctcggcgacgacagcgttccgcagaacgccgggataaaaaaggtgatggcactcatg
tgcggcccaccacccatggtgcagatggcgatcaagccgaacctagagcgtatcggctac
accgccgacagcatgttcaacttctaa

DBGET integrated database retrieval system