KEGG   Leishmania braziliensis: LBRM_15_0170Help
Entry
LBRM_15_0170      CDS       T01113                                 

Definition
putative serine/threonine-protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     LBRM_15_0170
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   LBRM_15_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:complement(70878..73268)
Genome map
AA seq 796 aa AA seqDB search
MLACVLPPSCPFCCSRRCLSLFAFLFPHHFSLSPLLHPPPYLFWQKRSEPAMADSSKATL
SQMSTETLLQQLCGMRTALEEESHAPYEAEAEATQVDSSHRHHHYGNAAVVGVSWYSSDV
AHVSHSESSAPREPVMEPREARVVDAAPDHARSKSSVSQISASTAARPRPSSSQLSPHTT
GDGFSVSSVRSLPDAHADPTAPSVAPVTPVVTEGSDHSAVSASTKGRLSHVHAAAAAGAP
SSSASSSTTGPPPLTVAPLGGARTTTAAKEHPLAPATTRTRTGFSNGEVPPHPGLAASTQ
AGAAPPPSLPLLSSSHPTTSSAAATTPATFSSGAVVKEGSGGGAGVSASEETDPYGRPAI
ALSVHLLDLYKMVNARYCAQRRLESPGPKYNSGYDDKDGHYLFLPGEVIFQRYIAQEVLG
KGSFGTVIRGFDQKRSEAVAMKITRRGSSFRSQAKLELDILLRLNENPALNHLVVRLLKV
FEWQGHLVLVFELLSFNLYQLIKCTRFNGVSLDLVRKFAYQLTHTLLQLESQKPQPIIHC
DLKPENILLRSQNRSGIRLIDFGSACYAAKRFHRYIQSRFYRSPEVILFLEYGTPIDRWS
LACVLVELHTGVPLFDGRTEAAQLAKIEATLGPIPARMVAGSPKANRFYYGNVTSGFQLK
EPVPERRTLESIIGVTTGGPRGRRLNTPGHDEQVYRDFHDFIAGFLRYQPEERMNCRDAL
QHPFLMPLYTSDLQLQKDREDAQPVAAPPLSQQQQQEQPPQSSQSSQPQQQHMTVAATTE
PSSVEHSYAPAVLPAR
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcttgcgttctccctccctcctgccccttttgttgctcacgacggtgtctctct
ctcttcgcctttctcttccctcatcacttttccctctccccacttctccatccccccccc
tacttgttctggcagaaacgaagtgagccagcgatggcggactcttcgaaggccacattg
tcacagatgagcacagaaacacttctgcagcaactctgtggcatgcgcacagcgctggag
gaggagagccatgcaccgtatgaggcggaggcagaggccacgcaagtggatagcagtcac
cgccaccaccactacggtaacgctgccgtcgtaggagtcagttggtactcgtccgatgtc
gctcatgtcagccactcggagtcgagcgcgcccagggagcccgtcatggagccgcgagag
gctcgagtggtggacgcagcgcctgaccacgcaagaagtaaaagcagcgtctcccagatc
tcagcctcaactgcagctcggcctcggccttcgtcgtcgcagctgtctccccacaccaca
ggcgacggcttctcagtgtcttcggtgcgtagccttcctgacgcccacgccgatccgaca
gcgccgtcggtggcaccagtgactcccgtagtcacagagggtagtgaccattcagccgtg
tctgcgtccaccaagggccgactcagtcacgtgcatgccgccgctgcagcaggtgcgccc
tcttcttccgcgtcctcctccaccactgggccaccgccgctgacggttgcgccgttgggg
ggcgcgaggaccaccactgctgccaaggagcaccctcttgcacctgccacgacacgcacc
agaacgggttttagtaatggcgaggtaccgcctcatcctggactcgccgcctccactcag
gccggcgcagcgccgccaccatcgctcccactgctatcctcatcccaccccaccacatct
agtgcggcggcgacgacaccggccacgttttcctcgggtgctgtcgtgaaggagggtagc
ggcggcggcgcgggcgtaagtgcctcggaggagacggatccctacggccgcccagccatc
gcactcagcgtacacctgctggatctgtacaagatggtaaacgcgcggtattgcgcgcag
cggcgcctcgagtcgccgggaccaaagtacaacagcggctacgatgacaaggatggccac
tatttgtttctgccaggggaggtgatcttccagcggtacattgcgcaggaggtattgggt
aaaggcagtttcggcaccgtcattcgcggctttgatcagaagcggtccgaagcggtggcg
atgaagatcacgcgacgtggctcgagttttcggagccaggcaaagctggagctcgacatt
ctgttgcgccttaacgagaatccagcgttgaaccacctcgtggtgcgactgctaaaagtg
tttgagtggcagggccatcttgtgttggtgtttgagctgctgagcttcaacctataccag
ctcatcaagtgcacccggttcaacggtgtgagtctcgatctagtgcgcaagtttgcctat
caactcacgcacacgctgctgcagcttgagtcacagaagcctcaaccaatcattcactgc
gacctgaagccggagaacatactgctgcgcagtcaaaacagaagtggcatccgcctgatc
gactttggctctgcctgctacgcggccaaacgcttccaccgttacattcaaagccgcttt
taccgcagccctgaggtgatactttttcttgagtacggcacaccgatcgatcgctggtcg
ctggcgtgtgtgctggtcgagttacataccggcgtccccctgtttgacggtcgcacagag
gcggcgcagctggcaaagatcgaagccaccctcgggccgataccagcgagaatggtggcg
gggtcgcccaaggcaaaccggttctactacggtaacgtcacgtcgggattccagctgaag
gagcccgtcccggagcggcgcacgctcgagagcatcatcggcgtcaccaccggtgggccg
cgcggccggcgtctcaacactcccggtcacgacgaacaggtgtaccgcgatttccacgac
ttcatcgcgggctttttacgatatcaaccagaggagcggatgaactgccgtgacgcactg
cagcatcccttcctgatgcccctgtacacatcagatcttcagctgcagaaggatcgtgaa
gatgcccagccagtagccgccccgccgctctcacaacagcagcagcaagagcaacccccg
caatcctctcagagcagccagccacagcagcagcacatgactgtcgcagcgacaactgaa
ccctcctctgtagagcacagctacgcccctgctgttcttccagcccgctag

DBGET integrated database retrieval system