KEGG   Leishmania braziliensis: LBRM_15_0300Help
Entry
LBRM_15_0300      CDS       T01113                                 

Definition
putative replication Factor A 28 kDa subunit
Orthology
K10739  
replication factor A2
Organism
lbz  Leishmania braziliensis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LBRM_15_0300
   03420 Nucleotide excision repair
    LBRM_15_0300
   03430 Mismatch repair
    LBRM_15_0300
   03440 Homologous recombination
    LBRM_15_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:108970..109521
Genome map
AA seq 183 aa AA seqDB search
MASGGGAITAKHFGYRITDNTGMLVVRQWIDADRVQEPIPLNAHVRASGTVNVWQQTPIV
TGTVVSMADSNEMNYHMLDAILTHFRLTQGNKRTQHSGASVQNTASAVGMHNMLPGGDNK
VLLTDLLVSFIKQHGSGGAGMSMDELTMAAQRYSFTHGDVRTAMRTLAAEGKVYQTHDNR
FNI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcctctggtggtggcgccatcaccgccaaacactttgggtaccgaatcaccgacaac
acgggcatgctcgtcgtgcgccagtggattgatgcggacagggtccaggagcccattccc
ctgaacgcgcacgtccgggcgtctggcacagtgaatgtgtggcagcagaccccaatcgtc
acgggtaccgtggtgagcatggcggacagcaacgagatgaactaccacatgttggacgcc
attctgacgcacttccgcctgacacagggcaacaagcgtacccagcacagtggggcctca
gtgcagaacacggcctcggcggttggcatgcacaatatgctgcctggaggcgacaacaaa
gtgttgctgacggacctcctcgtctccttcatcaagcagcatggaagcggtggggcaggc
atgtcgatggatgaactaaccatggcagcgcagcgctacagcttcactcatggcgacgtg
cgcacggcgatgcggacgctggcagcggagggaaaagtgtaccagacccacgacaaccga
ttcaacatctga

DBGET integrated database retrieval system