KEGG   Leishmania braziliensis: LBRM_15_0300Help
Entry
LBRM_15_0300      CDS       T01113                                 

Definition
(RefSeq) putative replication Factor A 28 kDa subunit
  KO
K10739  
replication factor A2
Organism
lbz  Leishmania braziliensis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LBRM_15_0300
   03420 Nucleotide excision repair
    LBRM_15_0300
   03430 Mismatch repair
    LBRM_15_0300
   03440 Homologous recombination
    LBRM_15_0300
DNA replication proteins [BR:lbz03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    LBRM_15_0300
DNA repair and recombination proteins [BR:lbz03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     LBRM_15_0300
   MMR (mismatch exicision repair)
     LBRM_15_0300
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     LBRM_15_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
15:108970..109521
Genome map
AA seq 183 aa AA seqDB search
MASGGGAITAKHFGYRITDNTGMLVVRQWIDADRVQEPIPLNAHVRASGTVNVWQQTPIV
TGTVVSMADSNEMNYHMLDAILTHFRLTQGNKRTQHSGASVQNTASAVGMHNMLPGGDNK
VLLTDLLVSFIKQHGSGGAGMSMDELTMAAQRYSFTHGDVRTAMRTLAAEGKVYQTHDNR
FNI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcctctggtggtggcgccatcaccgccaaacactttgggtaccgaatcaccgacaac
acgggcatgctcgtcgtgcgccagtggattgatgcggacagggtccaggagcccattccc
ctgaacgcgcacgtccgggcgtctggcacagtgaatgtgtggcagcagaccccaatcgtc
acgggtaccgtggtgagcatggcggacagcaacgagatgaactaccacatgttggacgcc
attctgacgcacttccgcctgacacagggcaacaagcgtacccagcacagtggggcctca
gtgcagaacacggcctcggcggttggcatgcacaatatgctgcctggaggcgacaacaaa
gtgttgctgacggacctcctcgtctccttcatcaagcagcatggaagcggtggggcaggc
atgtcgatggatgaactaaccatggcagcgcagcgctacagcttcactcatggcgacgtg
cgcacggcgatgcggacgctggcagcggagggaaaagtgtaccagacccacgacaaccga
ttcaacatctga

DBGET integrated database retrieval system