KEGG   Leishmania braziliensis: LBRM_16_1360Help
Entry
LBRM_16_1360      CDS       T01113                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
lbz  Leishmania braziliensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    LBRM_16_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16:complement(519680..520024)
Genome map
AA seq 114 aa AA seqDB search
MPPKARAPLPPGDAERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIINRKSGTIEGFAYS
KANADSGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLKD
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtgctcccctcccgcctggtgatgcggagcgtggtgagaagctg
ttcaagggtcgcgctgcccagtgccacaccgccaccaagggaggttctaacggcgtgggc
ccgaacctgtttggcatcattaaccgcaaatctggcacgatcgagggctttgcgtacagt
aaggcgaacgctgactctggcgtgatctggacgccggaggtgctggacgtgtacctggag
aacccgaagaagtttatgcctggcacgaagatgtcgttcgctggcatcaaaaagccgcag
gagcgcgctgacgtgattgcgtacctcgagactctgaaggattga

DBGET integrated database retrieval system