KEGG   Leishmania braziliensis: LBRM_17_1210Help
Entry
LBRM_17_1210      CDS       T01113                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase-like protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     LBRM_17_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17:543004..544623
Genome map
AA seq 539 aa AA seqDB search
MPTAMRTAIIAVVHLALTWVLLGYIADSAMPFYAYCAGGNDTAAAVSGTFVFAAATHDWG
QWPLFLRSNQEAYMAQLAQHQCAMSASDAATLNSRVVQRSSVFHLTLAIITYVLLRFVVT
APYGRHAEGLGLRLTLPSRLSWMLQESPAILQVLYHVLLEYPRVMGHGFSLSSKWSLSSS
TPGWIVAGVAGRDSSVDTCQSYWGCVWTACTQQHLGLLLFSIHYVHRSWCYPLSIPASAH
GVPLALTWMATLYCLFNGRLQVLASAGAAVAACPTGTATWSSACAPAYTPSMSFVRCWRK
RHELQSSFSASSVGAAAVHIAWWFLLFLYTVGVFGGSALFFAGQRINMQADYYLIALRRR
GEDNISDDRSKPVGQSAASLDGDVLVSSSSGASRAAQQRSRGGGYRIPVSGWFDCVSCAN
FFGELVEWTGYVIVVSATSAASNGSCHSVATALEDELLRPLSSSSWWSLMNPMMWLRLVM
RVFCSGAESHPAALAAFSFLVYVFSNLAPRAVAHHAWYAKTFGDRYTRLGRKALLPGVY
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcccactgctatgcgcaccgccatcatcgctgtcgtgcaccttgcgctcacgtgggtg
ctgctgggctacattgcagattcagccatgcccttctacgcgtactgcgcggggggcaat
gacactgccgctgcagtcagtggcacctttgttttcgcagctgcgacgcacgactggggc
cagtggccacttttcctcaggtcgaaccaggaggcgtacatggcgcagctcgctcagcat
cagtgcgccatgtcggcttccgatgctgccactctcaatagtcgcgtggtgcagcgcagc
agcgtgttccacctcacgctcgccatcatcacgtacgtattgctgaggttcgtcgttacg
gccccgtacggccgccatgccgagggactcggccttcgtcttactctcccctcgcgcctc
agctggatgctgcaggagagtccggctattttgcaggtcctctaccacgttctgctggag
tacccgcgcgtcatggggcacggcttttcactgtcatcaaagtggtcgttgtcctcctcc
acccctggctggattgttgctggggtagctggcagggattcctcggtggacacctgtcag
tcctactggggctgtgtgtggacggcctgcacgcagcagcaccttgggcttcttctcttt
tcgatccactacgtccaccgcagctggtgctatccgctgtcgatcccggccagcgcgcat
ggtgtgccgctcgctcttacgtggatggcaaccctgtactgtctcttcaatggtcgtcta
caggtgctggcgagcgcaggcgcggccgtcgcggcctgtccaactggcactgcaacgtgg
tcgtcggcctgcgctcccgcgtacacgccatcgatgagctttgtgcggtgttggcgcaag
cgccatgagctgcagtcatctttcagtgcctcctctgtgggagctgctgctgttcacatt
gcctggtggtttctcttgttcctctacactgttggcgtctttggtggctcggcactgttc
ttcgctggacagaggatcaacatgcaggcagactactacttgatcgctctgcgtcgccgt
ggcgaagacaacatcagcgacgaccgcagcaagcctgtggggcaaagtgcggccagtctg
gacggagatgtattagtatcgtcatcgtctggggcgtctcgtgccgctcagcaacgcagc
agaggtggcggctatcgcatccctgtcagcggctggttcgactgcgtcagctgcgcgaac
ttctttggcgagcttgtcgagtggacaggctacgtcatcgtcgtttcggcgacgtctgcc
gctagcaatggcagctgtcactccgttgcgactgccctcgaggatgaactgctgcggccg
ctctcgtcgtcgtcttggtggtcactcatgaacccaatgatgtggttgcgtctcgttatg
cgagtattctgcagcggggcggagtcgcacccggcagcgttggcggcgttcagcttcctc
gtgtacgtcttcagcaacttagccccgcgtgcggtggcgcatcatgcctggtacgccaag
acgttcggcgatcgctacacgaggctcggccgcaaggcgcttctaccaggggtgtactag

DBGET integrated database retrieval system