KEGG   Leishmania braziliensis: LBRM_18_1050Help
Entry
LBRM_18_1050      CDS       T01113                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbz  Leishmania braziliensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBRM_18_1050
   00052 Galactose metabolism
    LBRM_18_1050
   00500 Starch and sucrose metabolism
    LBRM_18_1050
   00520 Amino sugar and nucleotide sugar metabolism
    LBRM_18_1050
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBRM_18_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18:394892..396364
Genome map
AA seq 490 aa AA seqDB search
MEIDMKAISAAAQACVKKMRDAKVNEACIRTFIAQHVMVSNGETGSIPDSAITRIESLDE
LEGLTTECDNAVLQSTVVLKLNGGLGTGMGLHDAKTLLDVKDGKTFLDFTALQVQYLRQH
CSERLRFMLMNSFNTSASTRRFLEARYPWLYQVFDSEVELMQNQVPKILQDTLEPVTWPE
DPGCEWAPPGHGDIYTALYGSGKLQELVNQGYRYIFVSNGDNLGATIDKRVLAYMEEKQI
DFLMEVCRRTESDKKGGHLARQVVCAKSKGSQPDASTGGLLLLRELAQCPKEDMNNFQDI
NKHSFFNTNNLWIRLPALLATMEKHGGTLPLPVIRNEKTVDPSNPASPKVYQLETAMGAA
IAMFENASALVVPRSRFAPVKTCADLLALRSDAYVVTNDSRLVLDDRCHGHPPVVDLDNA
HYKMMGGFEKLVQNGVPSLVKCKRLIVKGLVQFGTDNVLTGTVKIENAHSASAFVTPDGA
KLTDTTVSPP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgacatgaaggccatcagcgccgccgctcaggcgtgcgtaaagaagatgcgc
gacgccaaggtgaacgaggcgtgcatccgcaccttcattgcgcagcacgtcatggtcagt
aatggtgagacagggtcgattcccgactccgccatcacgcgaattgagtccctcgatgag
ctggagggactcaccactgagtgcgacaacgctgtcctgcagagcaccgttgtattgaag
ttgaacggcggtctcggcaccggtatggggctgcacgacgccaagacgctgcttgatgtc
aaagatggaaaaacgtttcttgactttacggcactgcaggtgcagtatcttcgccagcac
tgcagcgagcgtctgcgcttcatgttgatgaatagcttcaacacctccgctagcaccagg
aggttcctggaggctcgctacccgtggctgtaccaggtttttgactcagaggtggagctg
atgcagaaccaggtgcccaaaatattgcaagacaccctcgaaccggtaacatggcccgag
gacccggggtgcgagtgggcgccgccggggcatggcgacatctacaccgctttgtatggc
tctggcaagctacaggaacttgtcaaccagggctaccgctacatcttcgtcagcaacggt
gacaacctcggagccaccattgacaagcgcgtgctggcgtacatggaggagaagcagatc
gactttctgatggaggtgtgccgccgcacggagagcgataagaaaggcggccacctggcc
cggcaggtcgtgtgcgctaagtcaaagggctctcagccagatgccagcacgggagggtta
ctgttgctgcgggagttggcccagtgtcccaaggaggatatgaacaatttccaagacatc
aacaagcactccttctttaacactaacaacttatggatacggctcccggcgctgctggcg
acgatggagaagcacggcggcacactaccgttgccagttatccgcaacgagaagacggtc
gacccatctaacccagcatcgcccaaagtgtaccagctagaaactgccatgggcgccgcg
atcgccatgttcgaaaacgcatcagccctcgtcgtgcctcgcagccgcttcgcaccagtg
aagacgtgcgccgacctgctcgctctgcgctccgacgcctatgtcgtgacgaacgactct
cggctcgtactggacgatcgctgccacggtcatccacccgtcgtcgacctcgataacgcg
cactacaagatgatgggcggctttgagaaactcgtgcagaacggcgtgccatcactggtc
aagtgcaagcgcttgatagtgaagggactggttcagttcggcactgacaacgtgctgacg
ggcacagtcaagatcgagaatgcgcacagcgcctcggcgttcgtgacacccgatggcgcc
aagctgaccgacacgacagtgtcaccgccgtag

DBGET integrated database retrieval system