KEGG   Leishmania braziliensis: LBRM_18_1180Help
Entry
LBRM_18_1180      CDS       T01113                                 

Definition
protein kinase A catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LBRM_18_1180
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LBRM_18_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18:459459..460457
Genome map
AA seq 332 aa AA seqDB search
MVTKVEASKWRLSDLEMRETVGTGTFGRVRLVRHKGTGQYAALKILKKQEVLRMKQVDHV
MAEASLLQEIDHPFIVNMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCA
EVILAFDYLHSKTIVYRDLKPENILLDQDGNIKITDFGFAKRVAERTFTLCGTPEYLAPE
IIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILVGKVLFPRWVDSKARDF
IKGLLSLDPTKRLGNLPNGAEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFD
KYPDSPLNAFRTLTASQQDCFANFCNGQYTDD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccaaggttgaggcttccaaatggaggctgagtgacttggagatgcgtgagacg
gtcggcaccgggactttcgggcgagtacgcttggtgaggcacaagggaacaggccaatac
gcggccctcaagatcctcaagaagcaggaggtactccgaatgaaacaggttgaccacgtg
atggcggaggcaagtcttctccaggagatcgatcaccctttcattgttaacatgctacgg
ggatacatggacaagaaccggctgtacattcttctcgaatacgtggtaggcggcgagctg
ttctcgcatctccgcaaggccggcaagtttcctaatgatgtatcgaagttctactgcgcg
gaggtgatcctagcgtttgactacttgcacagcaagacaatcgtttaccgcgatctgaaa
ccggagaacatcctcctcgaccaggacggcaatataaagattacagattttggtttcgca
aagcgcgtggcggagcgtacgtttacgctttgcggcacacccgagtacctagcccccgag
atcattcagagcaaggggcacaacaaggctgtcgactggtgggcgctggggatcctgctc
tacgaaatgctggttggctacccaccgttcttcgacgacagcccgatgaaaatttacgaa
aagatccttgtaggcaaggttctcttcccgcggtgggtagactcaaaggcccgagacttc
atcaagggccttctgtccctcgatcccacgaagcgtctcggcaatctgcccaacggtgcc
gaggacatcaagaaccacaagtactttgcggaagtggactggaacgtagtgctgtccaag
aagatccccgcgccaatcccggtgcggcagcacaaggaaggtgacacccactacttcgac
aaataccccgacagcccactcaacgcttttcggactttgactgcatcacagcaggattgc
ttcgccaatttctgcaacggccagtatacggacgactag

DBGET integrated database retrieval system