KEGG   Leishmania braziliensis: LBRM_18_1180Help
Entry
LBRM_18_1180      CDS       T01113                                 

Definition
(RefSeq) protein kinase A catalytic subunit (EC:2.7.11.1)
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
18:459459..460457
Genome map
AA seq 332 aa AA seqDB search
MVTKVEASKWRLSDLEMRETVGTGTFGRVRLVRHKGTGQYAALKILKKQEVLRMKQVDHV
MAEASLLQEIDHPFIVNMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCA
EVILAFDYLHSKTIVYRDLKPENILLDQDGNIKITDFGFAKRVAERTFTLCGTPEYLAPE
IIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILVGKVLFPRWVDSKARDF
IKGLLSLDPTKRLGNLPNGAEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFD
KYPDSPLNAFRTLTASQQDCFANFCNGQYTDD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccaaggttgaggcttccaaatggaggctgagtgacttggagatgcgtgagacg
gtcggcaccgggactttcgggcgagtacgcttggtgaggcacaagggaacaggccaatac
gcggccctcaagatcctcaagaagcaggaggtactccgaatgaaacaggttgaccacgtg
atggcggaggcaagtcttctccaggagatcgatcaccctttcattgttaacatgctacgg
ggatacatggacaagaaccggctgtacattcttctcgaatacgtggtaggcggcgagctg
ttctcgcatctccgcaaggccggcaagtttcctaatgatgtatcgaagttctactgcgcg
gaggtgatcctagcgtttgactacttgcacagcaagacaatcgtttaccgcgatctgaaa
ccggagaacatcctcctcgaccaggacggcaatataaagattacagattttggtttcgca
aagcgcgtggcggagcgtacgtttacgctttgcggcacacccgagtacctagcccccgag
atcattcagagcaaggggcacaacaaggctgtcgactggtgggcgctggggatcctgctc
tacgaaatgctggttggctacccaccgttcttcgacgacagcccgatgaaaatttacgaa
aagatccttgtaggcaaggttctcttcccgcggtgggtagactcaaaggcccgagacttc
atcaagggccttctgtccctcgatcccacgaagcgtctcggcaatctgcccaacggtgcc
gaggacatcaagaaccacaagtactttgcggaagtggactggaacgtagtgctgtccaag
aagatccccgcgccaatcccggtgcggcagcacaaggaaggtgacacccactacttcgac
aaataccccgacagcccactcaacgcttttcggactttgactgcatcacagcaggattgc
ttcgccaatttctgcaacggccagtatacggacgactag

DBGET integrated database retrieval system