KEGG   Leishmania braziliensis: LBRM_19_1710Help
Entry
LBRM_19_1710      CDS       T01113                                 

Gene name
MPK4
Definition
(RefSeq) mitogen-activated protein kinase
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
19:679322..680413
Genome map
AA seq 363 aa AA seqDB search
MTQLVPLAELPSGKKIYSVRGQGFEVDREYDLVKIIGFGAYGTVCSAVANRSGERVAIKR
LSRVFGDLREGKRILREMEIMTSLKHSNLIRLHHFLRPHSKETFEDIYFVMDLYDTDLNR
IIRSRQKLTDEHLQYFMIQAFRGLHYLHSAKVMHRDLKPSNLLVNADCALAICDFGLARD
DQVMSSSDLTQYVVTRWYRPPEVLGMGFNQYTSAVDVWSLGLIFAELMVGRTLLPGTDYI
EQLVMIVNLLGSPSIDDMEFLSSEARAFILSQPHRPALPFRDLFPMATEEATDLLSKLLV
FHPARRLTAKQVMEHPYFSKYRDPAEEADAPNPFVWNHSHIETKAQLREDLWRVVEAYSH
SNE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgactcaactcgtccctttagctgaactgcccagcggtaaaaaaatatatagcgtccgg
gggcaagggttcgaagtggacagggaatatgatctggtcaagattatcggatttggtgcg
tatgggactgtgtgttcagcggtcgcaaacagatcaggtgagcgggtggcaatcaagcga
ttgtcacgcgtttttggtgatcttcgcgaagggaaacgaattttgcgggagatggagata
atgacgtctctgaagcacagtaacctgattcgcctccaccacttcttgcggccgcactca
aaagaaacgttcgaggacatttattttgtaatggatctttatgacaccgatttaaatcgt
attatacgaagtcggcagaagctcactgatgaacatctacagtatttcatgattcaagcg
ttccgtggattacattacctccactctgccaaagtgatgcatcgagacctaaagccgagt
aacttgcttgtaaatgcggactgcgcgctggcaatctgcgattttggactggctcgtgat
gatcaagtgatgagctcgtcggatctcacccagtacgttgtaactcgatggtacagaccc
cctgaggtacttgggatgggtttcaatcagtatacgagtgcggtagatgtctggagcctt
ggtctgatttttgcagagctgatggtagggcgtaccttgcttccaggaaccgattatatc
gaacagctagtaatgattgtcaacctactaggatccccgtctatcgatgacatggagttt
ctgagctctgaggcacgggcatttattctctctcagccgcatcggccggctctccctttt
agagatctttttccaatggctaccgaggaagctactgatcttctctcaaaactgttagtc
tttcacccagcaagacgattaactgcgaagcaagtgatggagcatccatatttttcgaag
taccgagaccccgctgaagaagccgacgcccctaatccatttgtgtggaatcatagtcat
attgaaacgaaggcgcaactccgtgaggatttgtggcgcgttgtcgaagcttactcacat
tcgaatgaatag

DBGET integrated database retrieval system