KEGG   Leishmania braziliensis: LBRM_19_1750Help
Entry
LBRM_19_1750      CDS       T01113                                 

Definition
eukaryotic translation initiation factor-like
Orthology
K03259  
translation initiation factor 4E
Organism
lbz  Leishmania braziliensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LBRM_19_1750
Messenger RNA biogenesis [BR:lbz03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     LBRM_19_1750
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     LBRM_19_1750
Translation factors [BR:lbz03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LBRM_19_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19:688785..689621
Genome map
AA seq 278 aa AA seqDB search
MDPNRCSPESAATDEQPLTLLWGTWEMWCDIPRRQQGHGTENSNWLEQVKSIGLFDSAEG
FWGIFNCTILPSQLPPNSSYYLFRKHIAPMWEHEANRRGGKWIIPFTSKASEGGGDLQPV
DVAWETLCLSAIGELFPGDEEEICGVTVSRGKQRALPSGHVAPLLSEWKLCLWTRRADDR
VSQMEIAEYIRKELRLGLLSKETSRDGRNGEIDTPMEMPWSPDRSPAAKTREVSGFPSAI
TYMAHRDLMEARLDFVKGGSRVAPTFRPKYTLAIDVRG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggatccgaataggtgttccccagagagcgctgcgacagatgagcaaccacttactctg
ctgtgggggacgtgggagatgtggtgcgacatcccgcgccgacagcaaggccacggcaca
gaaaattccaactggctggagcaggtaaagagcatcggcttgttcgacagtgccgaaggc
ttctgggggatattcaactgcactatcttgccatcgcagcttccaccgaacagctcctat
tacctttttcgaaaacacattgccccaatgtgggagcacgaggcgaaccgtcggggcgga
aagtggatcattccctttaccagcaaggcgtcagagggtgggggtgatttgcagcccgtc
gatgtggcttgggagaccctgtgcctctctgcgattggggagctctttcctggtgacgag
gaggagatttgcggcgtcactgtgagtcgcgggaagcaacgcgccttgccctctggccac
gtggcgcctctgctaagtgagtggaaactttgtctgtggactcgccgtgctgacgacagg
gtgtcgcagatggagattgccgagtacatccgcaaggagctgcgcctaggcctcctgtcg
aaggagacgagtagagatggacggaacggcgaaattgacacaccgatggagatgccatgg
tccccagaccgttctccagctgccaagacgcgagaggtctctgggtttccatcagcaatc
acctatatggcacaccgggacttgatggaggcaaggctggattttgtgaagggcggcagc
agggttgctccaacgttcaggcccaagtacactcttgcaatcgatgtgagggggtga

DBGET integrated database retrieval system