KEGG   Leishmania braziliensis: LBRM_20_1700Help
Entry
LBRM_20_1700      CDS       T01113                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lbz  Leishmania braziliensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LBRM_20_1700
Enzymes [BR:lbz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LBRM_20_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34a:complement(714710..716011)
Genome map
AA seq 433 aa AA seqDB search
MRLSTPSAVRLLGALLVIACFVHASVAFPYGKSSAVTELTSSSLNAFVNTHKPVVILFYA
PWCGHCKQFHPEFERFAQLMKGIIRVGAIDADRNTHIGQQFGVRGFPTIKYWRSGAKSVS
SAQDYQGQRTAAALQSLMIGEISSSEVTKVTTAEEIKHAARNSPKKMIGVLLSLKNKVPP
MLSVMSLSPKLKQLPLVFSGNCNLHKGVAEAFGVTQLPMLGVLRYTPAEGDAAEKFELII
HEKNNISYESVAHFFLDCAENQCSSGTKTFVKSVNLDEDEKHLQTHGTARQATVALPVVP
VEYTPKVISQFCAPQTRKIRGQSPLCVFSLSERVHLDQVHKYFKNDPLLFFEASQHKEEL
LHELHSKFGVQLVSLGEAPASLTESIVVLRHSKPRAARYALLEHISSDEDLQAALQRILN
GEVHLISVDLGAV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcagtaccccctccgcagtgcggctcttgggtgcacttttggtgatcgcctgt
ttcgtgcacgcctcggtggcattcccgtacggtaaatcgtcggcggtcacggagctgacg
tcgtcttcgctgaatgcctttgtgaacacacacaagccggtagtcattctcttttacgcc
ccgtggtgtggacactgcaagcaattccaccccgagtttgagcggtttgcccagctgatg
aagggtatcatccgcgttggcgcaattgatgccgaccggaacacccacattgggcagcag
ttcggtgttcgtggctttccaacgatcaagtactggaggagcggcgcaaagtccgtctcc
tccgcccaggattaccaaggccaacggacagcggcggcactgcagagcttaatgataggg
gaaatcagctcgagtgaggtcacgaaggtgaccacagcagaagagataaagcacgccgct
cgaaactctccaaagaagatgattggcgtgttgctctccctgaagaacaaggtgccgcca
atgctgtcggtcatgtccctgtcgccgaagctaaagcagctgcccctggtgttctcaggt
aattgcaaccttcacaagggtgtggcggaggcctttggggtcacgcaactaccaatgctc
ggcgtgctgcgctacactccagcagaaggcgatgcagcggagaagttcgagttgataata
cacgaaaaaaataacatctcttacgagtccgtcgcgcactttttccttgactgcgcagag
aaccagtgcagctccggcacgaagactttcgtgaagtcagtgaaccttgacgaggatgag
aagcacctccaaacccatggcaccgcgcggcaggccaccgtcgcactcccagtggtgccg
gtcgaatacaccccaaaagtgatttcgcagttttgtgcgccgcaaactcgcaagattcgc
ggccagtctcccctgtgtgtcttcagtcttagcgaacgtgtccatctcgaccaggtacac
aagtacttcaagaacgacccgttacttttcttcgaggcatctcagcataaagaagagctg
ttgcatgagctccactctaagtttggcgtacagctggtgtctctaggagaggcgccagcg
tctttgacggagtccattgtagtcctacgccactcgaagccaagggcagcgcggtatgcg
ttgctggagcacattagctccgacgaggatttacaggcagccctgcagcgcattctgaat
ggggaggttcacctcatctcagtagaccttggtgctgtatag

DBGET integrated database retrieval system