KEGG   Leishmania braziliensis: LBRM_20_2230Help
Entry
LBRM_20_2230      CDS       T01113                                 

Definition
NADPH-cytochrome p450 reductase-like protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lbz  Leishmania braziliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34a:937307..939181
Genome map
AA seq 624 aa AA seqDB search
MTQLTILYGTQTGNAERLALRVARLALREGFECVSCLPADDVPIAEWRHTGGPVLLICSN
ANQGDAPNTFRRSWASLLQPTAAGCMEGLQYAIFGLGDSLYLKFNQMAKMVHNRLQQLGG
TPIVMRGLGDESDAKGIEETLQPWLAELWKALERPGKYVAAAGVSAYPQEDLPFFPLFSI
APASTSDEVTVGAPSSSTDVTAASLPYFADHVFPCEVVSNRRLTSAACEQVVHHLELRRN
SSSTAASAYDVGDALGIYCPNREESVEELLHLLQRDGAETVVVTPDASHGLVRQPTRPFF
GRPLSLRSLLRHYFDLDAVVTQEFLWMLAHEVTGVGEDARDVQERLYELANPSNVDDYLQ
YAHREKRNVCEVLHDFKDLHPSLELVLSFTTPMLPRYFSVASAPAMDGANRYDLCVGLLD
WHTPLKRHRTGLCSSYLVRATPGTQLTCSVWQGSLALPAAPTPLLCVATGTGVAPVRSVL
RQVAGLSAQGWKDVPVVLVFGCRHEAEDYLYREEWVALKEIGALPTLLVIPAFSRDTDKK
VYVQHKLGQHARLTSSFLQPDGAGVPPGVVYVCGNAKQMPKDVQHTLERIVEATVAEVHG
EAGAAAYVRRLGRVGRYQVDSWSV
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcttacgattctgtacggaacgcagactggcaacgccgagcggctagcgctg
cgcgtcgctcgactggcacttcgcgaagggtttgagtgcgtctcgtgcctgcctgccgat
gacgtgcccatcgctgagtggcgacacacaggcggacctgttcttcttatctgctcgaac
gcgaatcaaggtgatgctcccaacacatttcgccggtcgtgggcgtcgctactacagccc
actgcggctggttgcatggagggcctgcagtacgccatcttcggccttggcgactcgctg
tacctcaagttcaaccagatggccaagatggtgcacaaccgtctccagcagctgggcggc
acaccaattgtgatgcgcgggctgggagatgagagcgacgcgaaaggcatagaggaaacc
ttgcagccctggctcgcggagctatggaaggcgcttgagaggccaggcaagtacgttgcc
gccgcaggtgtgtcagcttatccgcaggaggaccttcctttctttcctcttttcagtatt
gcacctgcctcaacgagcgacgaggtcactgttggcgcgccgtcctcttccactgacgtc
actgctgcgtcactaccatattttgccgaccatgtgttcccctgcgaggtggtgtcaaac
aggcgcctcacatctgctgcgtgcgagcaggtggttcatcacctggagctgcgcaggaac
tctagcagcacggccgcctcagcgtacgatgtcggcgatgcgctgggcatctactgcccc
aatcgtgaagaatccgtagaggaactgctgcacctattgcagcgagacggtgcagagacg
gtggtggtgaccccagacgcttcgcatggacttgtccgtcagcccacccgtcccttcttt
gggcggcctctctcgctacggtcgttacttcgtcactactttgatcttgatgccgtggtg
acccaagaattcttgtggatgctcgcacatgaagtgactggggtaggcgaggacgcacgc
gatgtgcaggagcgcctctacgagctggcaaacccgtccaacgtggacgactaccttcag
tatgcgcaccgtgagaagcgtaacgtgtgcgaggtgctgcatgacttcaaggaccttcac
ccatctctagagctggtcttgtccttcacaacgccaatgctgccgcgctacttctccgtc
gcctccgcgccagcgatggacggcgcaaaccgctatgacctctgtgtggggctactggac
tggcacacgccactgaagcgccaccgcacggggctctgcagctcctacctggtgagggcg
accccagggacacagctgacgtgctctgtttggcagggttctcttgcacttccggctgca
ccgacgccgctgctctgcgtcgcgacggggacgggcgttgcaccagttcgcagtgttctg
cgtcaggtcgccggtctttccgcgcagggctggaaggacgtgccggtggtgctcgtcttt
ggatgccgccatgaagccgaggattacctgtaccgcgaggagtgggtggcgctgaaggag
attggcgcactgcccaccctcttagtcatcccagccttctcgcgagacaccgacaagaag
gtttacgtgcagcacaaactcggccagcacgcaagactgacgtcgtcctttctgcaaccc
gatggcgccggtgtcccgcctggcgtggtgtatgtgtgcggaaatgcgaagcagatgccg
aaggatgtgcagcacactctagagcgtattgtcgaggcaaccgtggcggaggtgcatggc
gaggccggcgcggcagcgtacgttaggagacttggccgcgtgggtcgctatcaggttgat
tcgtggtcggtgtag

DBGET integrated database retrieval system