KEGG   Leishmania braziliensis: LBRM_20_2970Help
Entry
LBRM_20_2970      CDS       T01113                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lbz  Leishmania braziliensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_20_2970
Enzymes [BR:lbz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     LBRM_20_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34a:1196461..1197366
Genome map
AA seq 301 aa AA seqDB search
MFAFAPDPRGRNSITLHNEDGSSITVYEQGAHLSSWKTKDEKEHLYLSPAAIYADGTALR
GGVPLIFPQFNAYGPMKPPHGFARIRPWNIEDVQNGKATFSLSTSLCELLPEGCSLAGAA
TNAVNLLYTICFSNTELKLRMKVTNTSEEHSAPFQFAFHTYFAVSDISQTVINGVNRSPF
IDNGKACGNPHTEPSPPEPLWTIQGEHDRIYPGQSCAIVLQDLGAKAALQISSPNLCDVC
LWNPGAVKCAAMKDMPADGYKRFVCVEHGSMLKKIVVTPCSSWTGSQEITITTQSPQESN
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccttcgctcccgacccccgcgggcgcaacagcatcaccctccacaacgaagac
ggctccagcattaccgtctatgagcaaggcgcgcacctcagcagctggaagacgaaggat
gaaaaggagcacctctacctcagccccgctgcgatctacgctgacggcacggctctgcgt
ggcggcgtgccgctcatctttccgcagttcaatgcctacggcccaatgaagccgccgcac
ggtttcgcgcgcattcgtccgtggaacatcgaagatgtccagaatggcaaggcgaccttc
tctctcagcacgtcgctgtgcgagctgcttccggaaggttgctcccttgctggtgccgcg
acaaacgccgttaacctgctctacacgatttgcttcagcaacacggagttaaagctgcgc
atgaaagttacgaacacgagcgaggagcactcagcgccgtttcagtttgccttccataca
tactttgcggtatccgacatttcgcagacggtgatcaacggtgtcaaccgctcgcctttc
atcgataacggcaaggcatgcggtaacccgcacaccgagccgagtccaccggagccgctg
tggaccattcaaggcgagcacgaccgtatttaccccggccaatcgtgcgccatcgtgctc
caggacctcggtgcaaaggccgcgctacaaatctcgagccctaacctgtgtgacgtgtgc
ctctggaatcccggcgcagtcaagtgcgccgcgatgaaggatatgccggcggatggctac
aagcgcttcgtatgcgtggagcacggcagcatgcttaagaagatagtggtaacgccgtgc
tcgagctggactggatcgcaggagatcacgatcacgactcaaagccctcaagaatcaaac
atatag

DBGET integrated database retrieval system