KEGG   Leishmania braziliensis: LBRM_20_3550Help
Entry
LBRM_20_3550      CDS       T01113                                 

Gene name
TOR3
Definition
putative target of rapamycin kinase (TOR) kinase 3
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lbz  Leishmania braziliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34a:1397047..1404921
Genome map
AA seq 2624 aa AA seqDB search
MTETLAAGDMGSISVTKLFSSDSTAALGQQLSSIFSNLNSTSKDRWQRSEECLSALMDTL
FLHEKELGANESLHERVIALIDSAFCNSVDKGCSSFRVVFDIKWKDQHEKRNRCFMLLLS
RAFKCTTPEECLKVIQCLGEVLEDNIRTTTDLLTDHVEALLKDLFAADVHRRTVVCEVLA
KIVSTAAFIIKRNPTLLELLTSSCAPLVTLKDAMETRNVWHRTALIRLTSALVKNCYEVT
PQVAKDVADLVLRYMRAAADESLLVGVLSALAHVAVTPAFVSAPWNLPQLVSFLCETDWS
VYSVATRVAAVTAASKVACFLCQEERDWYEALRTRLLEFISSDDSVEVGTEGLELLKEML
ISERELRLGGAVVKAVCACIQRLPYVPVIYELLELIRDRYGDLQMKPIYSLLEGYLGTEQ
ELLNFGKVNALLRFAGTRIRFDDPRLAQLRINVGVNRPIPVILHSLPLLTTLQRTEQLDE
VLEILSHDDPGVRRVAVTTALELCEIVIERNEAHVAKANGYAQRLNNNVSNAVERVLDVA
VADRDPEIRLWALQQFTASFFPYLCHADNLEAIFMARNDNDKATQAQALTLLCQLLPYRP
SIVQPQLQRTQRYMLHDVATMDASVSFAVCMAGLLKMCVDYDALLIQGSTVVTIVLQRLE
AQPFISRSLSIALLQLIRSILERTAPQDHFDPHLFLRPLLMIANGGDSCTRRREALETLA
AFISHITKTDISELSEVYRAVARIIRRETEEEESVTIAAMKVLSSIGAVTPVKMRHVFRK
VESDEMEEEEEVVTPALAHCKPRLRVSTDMPERYASAVLYYLVRSLQLALDPKQQVDTLA
AVRSMLHDVEGKVELNLLTQLLPQLQTWLRDPERAFLYETVLGLMNDLAILLCQFKETVA
PSVGYDLLRSVQAFCLLPQASQRPFRAYVVQLLDSLAKGIPAQDMRDNRWAVEFIHQRLS
QNKNDLDLVQRVVKSLESFTAVMHEKELQMILPHVLQCIEPAKASPDGKLSKSKNVNDAC
FDFLNFVMAKQLTLVKHCCAQIVHTIMWYIELAESNEEMDVGLHTLATLVDTVKMPAKRF
IMPIERVAVRKNFPPQYFVNLVKSAAGGAKTRMATSNGTDLNPDRPITVVSHLPRLSKDE
FEQELRSTPCSENVLIDVLDVRHHHGQTMIDFRFQPGMDTAARCSLFSRKATDNKSSMRR
NLGILRVEQREESPRPVGAKVIQALANLPVAKTKKREQSWVLWLHNATVTLLRNSPYAVL
RDTCAVADRNTELAKDLFPLAVTAVCGHLDTPLRAQLMEIFDRALAAAPADVKQGLFCFA
EFMEGERDEDHVKFVKVMRESVFSVDRESTSQKFGINYDQDPTLGVIVTKLAPNGVGARA
GVPIGAQLLAINDNPVRAVSDIRGLIEGHTHTELLLAYEVEERTKSIPTPLMNLEVLASV
AFSGEMHTKAIYFNEVLFESLSRKLCKVTDRKDNQMRRVMTIAEDLIQYYRHLNMTMTAN
GLLKMLTRKFSEIFAPEQFGFEEIASLEQLNWWSEALRRYEARMASCDTRCLEVASLVGV
LRCEQALGHSNRVQELAELYWDQLPTDAQCEVAPFRAKAAFCLGAWDIFDELAVDRRMQS
YFGVVERCAALFRTECYSELLHYTDKVRESMLESFADSLNESYSRAYEGMTRLQHLRHFE
ELVSFTTACSERQALLKRVWHRRLGQMSTRPDDLLTVLSINSLVLEPESDLDSYVYVIRS
LCKSQWFSHAEHLLQRLLHEDASLEVLCKCDPELIHTYIKYVYLAKDKQGAYVELKSILS
AVQVDAEDPRAETWGQCWLLLGEWTMYLFPEYGEEAITELTHATELGPNSAAAFHSLGIL
HCDLARDPSTQGEVQNRHLISCITSLFKSIQLCNDVPGSLVMQDVLRILSVWFANSGMRE
INEAVHYGVQVVADHVWLNVVPQLIARIGIEARYARAILTDLLIRVGSQYSHALIYPLTV
AEKSPDVVRRHMAERVIMGMRDIPENDRIVREASLVSNEMVRIAILWTEKWHAAIQQAAY
KPSNADTIFSMLQPLYEELDRASTPSELNFERTFGHTLRHAKIALEASKTDEAWGLLRQV
YAQLRRGVLERRLYMSDVSPTLDGIQDSIVAVPGTFEHDKPLITIRKFHSRVYVMPSKQK
PRRIGLDASDGKKYRFLLKGHEDMRQDERVMQFIRLIDTIFQSDNAASAIGLSIPQYAVI
PLTDNVGVVGWVENTETIYKMLETHRQAHEVSIYKEVNLIMKKGGLSTIEDYHQLPKQQR
KALLNYAMENTPKNELRQIFWNNNDTCEQWLSYRQTYGQTLAAMSMVGYVLGLGDRHLNN
LMLQGNGTVVHIDFGDCFEVAMHRAHYAEAVPFRLTRLLVCALGITGVDGVYRMTCELAM
KNLHRHSENLLSILEAFIYDPLINWRLNAVNDTTERSGSKSVQQEANNSASAALAGETAA
AARLGVDDASEGDAKPVAMQLSKSVSKPAPHSALPGESQMFENGEETRNQQGNLALARVQ
AKLTGQDFGMVNSSFSMMRSSRRLEGGDSQPHGSSWGSNSLAGFTDSPKDSFAAPLLTTY
LSLRVLNGGAESLDVPHQVDRLIQEATSLDNLSDAFLTGWAPFW
NT seq 7875 nt NT seq  +upstreamnt  +downstreamnt
atgacagagacgctcgccgctggagacatgggcagcatctctgtcacaaagctcttcagt
agcgatagtaccgctgcattgggtcagcagcttagctccatcttctctaacctcaatagc
acgtcgaaggaccgatggcagcgctccgaggagtgcctcagcgccttgatggacactctt
tttctacatgaaaaggagcttggcgcgaatgaatcgctccatgagcgtgtcattgccctg
atcgatagtgccttctgcaactccgtggacaagggatgcagctcatttcgcgtcgtattt
gacatcaagtggaaggaccaacacgagaagagaaatcgctgcttcatgctgctgttgagt
cgtgcatttaagtgcaccacgccggaagaatgcctgaaggtaattcagtgcctcggtgaa
gtactcgaggataacattcgcacgacgacagaccttctaacagatcacgtggaagcgctt
ctgaaagacctcttcgcagctgatgtgcaccgccgcactgttgtgtgcgaggtgctcgcc
aaaattgtgtcgacggctgcattcatcataaaacgaaacccaacactgctggagctcctc
acgtcgtcttgtgcgcctctggtgacactgaaggacgcgatggaaacacgaaatgtgtgg
caccgcacagcactcatccgccttacctccgcgcttgtgaagaactgctatgaggtgacg
ccacaagtggcgaaagatgtggctgaccttgtcttgcgctacatgcgcgccgcggcagat
gagtcgctgctggtcggtgtcctttccgctttggctcacgttgctgtgacgccagcgttt
gtttcggctccgtggaatttgccgcagctggtgagttttctctgcgaaacggactggtcc
gtctactccgtcgctacgcgagtcgccgctgtaactgcagcaagcaaagtagcctgtttt
ctttgccaagaggaaagggattggtacgaagcgctgaggacgcgtttgctagagtttatc
tcctcggacgactctgtggaggtgggaacggaagggcttgagctcttaaaggagatgcta
atctcagagagagagcttcgcttaggtggggccgtggtaaaggcggtctgtgcgtgcatt
caacgactgccctatgttcctgtcatctatgagctgctggagctcattcgggaccgctac
ggcgatctccagatgaagccgatctactcgctcttagaaggctacttgggcaccgagcag
gaactgctgaactttggcaaagtgaacgcgctactacgcttcgctgggactcggattcgc
tttgacgacccaaggcttgcgcagctgcgcatcaacgtaggcgtcaaccgaccgattccg
gtgatactgcactcactaccgctgctcacaacgttacagcggacggagcagctggacgaa
gtgctggagatcctctcgcacgacgacccaggtgtgcggcgcgtcgctgtcaccacagcg
ctggagctctgcgagatcgttatcgagcgcaacgaggcgcacgtggctaaggcaaatggt
tacgcgcagcgactaaataataacgtgagtaacgcggtggagcgtgtgctagacgtcgcc
gtggccgaccgcgaccctgagattcggctatgggcgttgcagcagttcaccgcgtccttc
tttccgtacctgtgccatgcggacaacttggaggctatctttatggcacgcaacgacaac
gataaagcaacacaggcccaggcactgacgctgctgtgccagttgctcccatatcgcccc
tccatagtgcagccgcagctgcagcgtacgcagagatacatgctgcacgatgttgctacc
atggacgcgtctgtgtccttcgcggtgtgcatggctggactgctgaagatgtgtgtggac
tacgatgccctcctaattcaaggaagcactgtcgtgacaattgtgttgcagcgattggag
gcgcagccttttatctctcgatcgctctccatcgctttgctgcagctcatccgctcaatc
ctagagcggacagcaccgcaagaccacttcgatcctcatttgtttcttcgaccgctcctc
atgattgccaacggcggggattcgtgcacgcgacgtcgcgaggcgttggagacgctggcg
gctttcatcagtcacatcaccaagaccgacatttcagagctgagtgaggtgtaccgggct
gtggcccgtatcatccgccgcgagacggaagaagaagagtccgtgacgattgctgccatg
aaggtgctcagctccatcggtgccgtgacccccgtaaagatgcgccacgtcttccgcaag
gtggagtcggatgagatggaggaagaagaggaggtggtgacgccggcactggctcactgc
aagccacgactgcgcgtctccaccgacatgccggagcgctacgcttctgcagtactgtac
tacctcgtgcgctcgttgcagctcgcgttggatccaaagcagcaggtggacacgttggca
gcggtgcgatcgatgctgcacgatgtcgagggaaaggtggaacttaatctactcacccag
ctgcttccgcaactgcagacctggctgcgcgacccggagcgggcatttctgtatgagacg
gtactgggcctgatgaacgaccttgccattctcctttgtcaattcaaggagactgtagcg
ccatctgtgggctacgacctactccggtctgtgcaagccttttgccttctcccgcaggcg
agccagagacctttcagggcgtacgttgtgcagctgcttgacagcctagcaaaggggatt
ccggcgcaggacatgcgcgacaaccggtgggccgtcgagtttattcaccagcggctttcg
cagaacaagaacgaccttgacttggtgcagcgcgttgtcaaatctcttgagtcgtttaca
gcagtgatgcatgagaaggagctgcagatgattctgccacacgtgctgcagtgcatcgag
cctgcaaaagcatcgcctgacggtaagctctccaagtctaaaaatgtcaacgacgcctgc
ttcgacttcttgaacttcgtcatggcgaagcagctgaccctcgtgaagcactgctgcgcg
caaattgttcacaccatcatgtggtacatcgagctggccgaaagcaacgaggagatggat
gttggcctacacaccttagcgacactggtggacacggtaaagatgccggcgaaacgattc
attatgccaatcgagcgcgtggcggtgcgcaagaactttccaccgcagtacttcgtcaac
ctcgttaagagcgccgccggtggcgccaagacccgcatggcaacgtcgaatggcacagac
cttaatccggaccgccccattacggtggtgtcgcatctgccgcgattgtcgaaggatgag
ttcgagcaggagttgcgcagcacgccgtgctcggagaacgttctcatcgacgtgcttgac
gtccgtcaccatcatggtcagacgatgattgacttccgctttcagcccggcatggacacc
gcggcgcgatgtagtctgtttagccgcaaagccacagacaacaagtcctccatgcgacgt
aatttgggtattctccgggtagagcaacgggaagagagcccacgtccggtcggggcgaag
gtcattcaggcactggcgaacttgccggtggcgaagacaaagaaacgcgagcagtcgtgg
gttttgtggctccacaacgccacagtgacgcttttgcgcaattccccgtatgccgtgctg
cgcgacacgtgcgctgtcgcggaccgcaacacggagcttgccaaggatcttttccccctt
gccgtaactgccgtgtgcgggcaccttgacacgccgctgcgggcgcagcttatggagatc
tttgatcgcgcgcttgctgcggcacccgcggacgtcaagcaggggctgttctgctttgcc
gagttcatggagggcgagcgagatgaggaccacgtgaagttcgtcaaggtgatgcgagag
agtgtgttcagcgtggatcgggagtcgaccagtcagaagtttggtatcaactacgaccag
gaccccacactaggtgtcatcgtgacgaagctggccccgaatggtgtaggcgctcgcgcc
ggcgtcccgattggcgcgcagctgctcgctatcaatgataatccagtgcgtgcggtcagc
gacattcgcggccttattgagggacacacgcatactgaactgctgctggcgtacgaggta
gaggagaggacaaagtctataccgacgccgctgatgaacttggaagtcctagcatctgtc
gccttcagcggggagatgcataccaaggcgatctacttcaacgaggtgctctttgagagc
ctctcacgcaagctttgcaaggttacggaccgcaaggacaaccagatgcgtcgtgtcatg
acgattgctgaggacctcattcagtattaccggcacttgaacatgaccatgacagccaac
gggctgctgaagatgctcacccgcaagttctctgaaatcttcgcgcctgagcagttcggc
tttgaggagattgcatcgttggagcagctcaactggtggagtgaggcgctgcgacgatat
gaggcgcgcatggccagctgcgatacccgttgcctcgaggtggcgtcgcttgtgggcgtg
ctaaggtgtgagcaagcgctggggcactcgaaccgcgtgcaggagctcgccgagctgtac
tgggaccagcttcccaccgacgcgcagtgcgaggtagcgccctttcgagccaaggcagcg
ttctgcttgggagcgtgggacatcttcgacgagctggcggtagacaggcgcatgcaaagc
tactttggtgtcgttgagcgctgcgccgcgctgtttcgaactgagtgctacagcgagctt
ttgcattataccgacaaggtgcgtgagtcgatgctcgagtcttttgccgactcgttgaat
gagagctacagccgcgcgtacgagggcatgacgcgtctgcagcacctgcggcactttgaa
gagctcgtttcattcactacggcgtgcagtgagcggcaggcgctgctgaagcgtgtgtgg
catcgccggctgggacagatgtctacccggccggacgatctcctgacggtgctctccatc
aactcacttgtgctagagccggagagtgacctggactcgtacgtgtatgtcatccgatcc
ctgtgcaagtcacagtggttctcgcacgcggagcacctcctgcaacggctgctgcacgag
gatgcctcgcttgaggttctatgtaaatgtgacccggagctgatccacacctacatcaag
tacgtttacctcgccaaggacaagcaaggagcgtatgtagagctgaagagcatcttgtcc
gccgtccaggtcgacgccgaagaccctcgagccgagacttgggggcagtgttggctgctt
cttggcgagtggaccatgtacctcttccccgagtacggcgaggaggccatcacggagctg
acacacgccacagagctaggccccaacagcgccgctgcctttcactcgctgggcatcctg
cattgcgatctcgcccgcgacccgagcacacagggcgaggtgcagaacagacacctaatc
tcctgcatcacctccctttttaagtccattcagctctgcaacgacgtaccgggcagcctc
gtgatgcaggatgtactgcgcattctctcagtctggtttgccaacagtggcatgcgggag
atcaacgaggcggtgcactacggagtgcaggtggtggcggaccacgtgtggctgaacgtg
gtgccgcagctcattgcccgcatcggcatcgaggcccgctacgctcgcgccatcctgacc
gacttactcattcgtgtagggtctcagtactctcacgccctcatctaccctctcacagtg
gcggaaaagtcgccagacgtggtgcggcggcacatggcggagcgcgtcatcatgggcatg
cgcgacatcccagagaacgatcgcattgtcagagaggcgtctttggtgagcaacgagatg
gtgcgcattgccattttgtggacagagaagtggcacgcggcgattcaacaggcggcctat
aaaccgagcaacgcggataccatcttctccatgctgcagccgctgtacgaggagctggac
cgcgcctccaccccgagtgagctcaactttgagcgcacgttcggtcacacgctgcgccac
gccaagatcgccttggaggcgtcaaaaacagacgaggcatggggtctcttgcggcaggta
tacgcgcagctgcgccgcggcgtgctggagcggcggctgtacatgagcgacgtctcaccg
acgctggatggcattcaagacagcattgtggcagtgcctggtaccttcgagcacgacaag
cccctcatcacgattcgcaagttccacagcagggtgtatgtgatgccatccaagcagaaa
ccgcgccgcatcggcctcgacgcgtccgatggcaaaaagtaccgcttcttactcaagggc
cacgaggatatgcggcaggatgagcgcgtcatgcagttcattcgcctgatcgacaccatc
ttccagtccgataatgcggcgagtgcgattggactgagcatcccgcagtacgctgtgatc
cccctcactgacaacgtcggcgtcgtcggatgggtggagaacaccgagacaatttacaag
atgctagagacgcacagacaggcacacgaggtgtccatttacaaagaggtcaacctcatc
atgaagaaaggcggactgagcacaatcgaggactaccaccagttgccgaagcagcagcgc
aaagcgctgctgaactatgcaatggaaaacactccaaagaacgagctgcgtcagatcttc
tggaacaacaatgacacgtgtgagcagtggctgagctaccgccaaacctacggccagacg
ttggctgcaatgtctatggtcggctatgtccttggccttggtgaccgccatctcaacaac
ctgatgctgcagggcaacggcaccgttgtccacatcgactttggcgattgcttcgaggtg
gctatgcatcgcgcccactacgccgaggctgttccgttccgcctgacacgtctgctagtg
tgcgctctcggtatcaccggcgtcgatggtgtttaccgcatgacatgcgagttggctatg
aaaaacctccaccgccatagcgaaaatctgctgtcgattctcgaggctttcatctacgac
cctctcatcaactggcgactcaacgcggtcaacgataccacagagaggtcggggtccaag
tcggtgcagcaggaggccaacaacagtgcttccgctgctttagcaggagaaactgccgct
gcggcccgcttgggggttgatgatgcgtcggagggtgatgctaaacccgttgctatgcag
ctgtcgaagtctgtatcgaagccggcgccgcactccgccttgccaggggagagtcaaatg
ttcgagaatggtgaggagacgcgcaaccagcaaggcaacttggccctcgcacgtgtgcag
gcaaagctcaccggtcaggattttggcatggtgaacagctccttctccatgatgcgctcc
tctcgccgtttggagggtggggactctcaacctcacggttcgtcgtggggctcgaacagt
ctcgctggcttcaccgactcgcccaaggactcgtttgcagcaccgctgctcaccacctac
ctttcgctccgcgttttgaacgggggtgcggagagcctggatgtgccgcaccaagtcgac
cgcctcattcaagaggcgacgagcctcgacaatttgtcggacgcgtttctcactggctgg
gcaccgttctggtag

DBGET integrated database retrieval system