KEGG   Leishmania braziliensis: LBRM_20_3690Help
Entry
LBRM_20_3690      CDS       T01113                                 

Definition
putative ubiquitin hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LBRM_20_3690
Peptidases [BR:lbz01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LBRM_20_3690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34a:1444863..1447574
Genome map
AA seq 903 aa AA seqDB search
MRSGYVGIYNQGSTCYLNSVIQALYHIPAFRRQIYNLPAVQEDSVALALRDVFAQLEVRN
RNTTTTELTKAFGWSAQEAAVQHDVHELMQQLFDSLETTLKETPQRNMIRDMFGGLMVYR
SRAVDGAEYLSDRLEDFYDVELVVQNKANIEESLREFSSGERIEGVCVELTPGADATPHT
IERSQHFLDCPKVLLVHPNRVAFDMETYELVTLRNVWSFDFNLSLSNYVVGDASLKLDKE
SQEKWKTISHRTHLGASYSLRSILTHAGDATIGHYYVYVNFDGEWVRFNDEVVESATEED
VHKSAFGGQSIQSRYRLFDNERASLLIYVNDDVKEELLHETPPPSAIVEVGRCIEEERTR
KEETRKMNYYVCDKSVVDVFDGVHGAPDKLQRQMSVRLSPGQDEMAAIITAAAKELQVTP
AQIRIFYRDRHGLSPWSAVETSNSYDSYYYPPIFVDVAPPEAQDDVAPATAATAEPFIAF
LRKIESQHDRDVPVTIVHSIPELQELVPHDSIVYESRGGPQYLSAITATNQLVCGANLLY
THQRSSMDTVRGYLQHRQLVCTKVYLYDDYTAEQTELFDLHIAESTPYSTLQMGLYKMMT
ESSKSLPTPPSHNYLGFFKGNDRCNYAFAMPMAPSLTIQWNTYNHTLRDVWGSVQHEHKI
VMTVLPMPLEKIDLTVLVTLNGGYNNLPRVYIPRECGSITFHELLELMLEQLSTRLRASA
VAGYKQQLAGKARLLRLLRVRRGELLDVVEQLDTLIDLESREDIVLDKLSPAIPGHELVN
VLFCRRRSGEYYFGLPTNICVNSSLEEQGDVLLRRIIKKLRYPDEEEAMKKWILCVMNAR
SRKTRTASKKEVLGDLVKEVGGAPFVLVVDRPQCLRLDGIEEEGHRTESIVIKSTSKTDL
SAN
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggggtacgttggcatctacaaccaaggtagcacatgctacctcaactcggtt
atacaggcgctgtaccacattcccgccttccgcaggcaaatctataaccttccagccgta
caagaggactcggttgctctcgcgctacgggacgtgtttgcacagctggaggtgcgcaac
cgcaacacgacgacgacggagctgaccaaggcttttggctggtcagcgcaggaggcggcg
gtgcagcatgacgttcatgagctgatgcagcagctctttgacagcctcgaaacgacgctg
aaggagacaccacaacggaatatgattcgcgacatgttcggcggcttgatggtctaccgg
tcccgtgcggtagacggcgctgaatacctctcggaccgccttgaggacttctacgacgtg
gagctggtagtgcagaacaaggctaacattgaagagtcactgcgggagttctcatcggga
gagcggatcgagggtgtgtgtgtcgagctgacgcctggcgctgacgcaacgccacacacg
attgaacgcagccagcacttcctcgactgccccaaggtcctcttggtacacccaaaccgc
gtggcatttgacatggaaacatacgagttagtcacactgcgtaatgtgtggagctttgac
tttaacttatcgttgtcaaactacgttgtcggtgatgcctcactgaagctcgacaaggaa
agtcaagaaaagtggaagacaattagtcatcgcacccacctcggcgcgagctacagccta
cgctctatcctcacacatgccggcgatgccaccatcgggcactactacgtgtatgtcaac
ttcgatggggagtgggtgcgctttaacgacgaagtggtcgagtcggcaacagaggaggat
gttcacaagtccgcgtttggcggacagtcgattcaatcgcgctaccgactcttcgacaac
gagcgcgcatcgctgctcatctacgtgaacgacgatgtcaaagaggagctgctgcatgag
acgccgccgccgagcgcgatcgtcgaggtaggccgctgcattgaggaagaacgcactagg
aaggaggagacgcgcaagatgaactactacgtatgcgacaagtccgtggtggacgtgttc
gacggcgtgcacggtgcgcccgacaagctgcagcgtcagatgtccgtgcgcctgtcccct
ggccaagatgagatggccgcgatcatcactgcagcagcaaaggaactgcaggtaacgccg
gcgcagattcgcatcttttaccgcgaccgccacggcctttccccctggtctgctgtcgag
acgagcaactcatacgactcgtactattacccgcccatatttgtcgatgtcgcgccgccg
gaggcgcaggacgatgtggcgccggccacggccgccaccgccgagccgttcattgcgttt
ctccgtaagatcgaatcgcagcacgaccgcgacgtccctgtcacaatcgtccactccatc
ccggagctgcaagagctggtgccgcacgactcgattgtgtacgagagccgcggcgggcca
cagtacctgagcgccatcacagcgacgaaccaactcgtgtgtggtgcaaatttactgtac
acccatcaacgctcgagcatggacacagtgcgtgggtaccttcagcatcgccagctcgtc
tgcacaaaggtgtacttgtacgacgactacactgccgagcagacggagctgtttgatctt
cacattgctgaatccacaccctacagtactctgcagatggggctctacaagatgatgaca
gagtcgagcaaaagcctgcctaccccgccctcccacaactacctcgggttctttaaagga
aacgatagatgcaactacgccttcgcaatgccgatggcgccgtcgcttacgattcagtgg
aacacgtacaatcataccctccgagatgtgtggggcagtgtgcagcacgagcacaaaatt
gtcatgacggttcttccgatgccgctcgaaaagatcgacttgacggtgctggtcacgttg
aacggaggatacaacaacttgccgcgcgtgtacattccacgggagtgcggcagcattaca
tttcacgagctgctcgagttgatgcttgagcaactgagcacccgactgcgcgcaagcgct
gttgcgggatacaagcagcagcttgccggaaaggcacggctgctgcggctgctgcgagtc
cgacgaggcgagttgctagatgttgtggagcagctggacactctgattgatcttgagtcg
cgcgaggacattgttctggacaagctgtctccggcgatccctgggcatgagctcgtcaac
gtgctcttctgccgccgccgctcaggagagtactactttggtctacccacgaacatctgc
gtcaactcctctctcgaggaacagggtgatgtgctgcttcggcgcatcatcaagaaactc
aggtacccagatgaggaggaggcaatgaagaaatggatactctgcgtgatgaacgccagg
tcgcgcaagacgcgcaccgccagcaagaaggaagtgctgggagacctcgtcaaggaggtt
ggtggcgcaccctttgtgctcgttgtcgatcgtccgcagtgcctgcgcctcgacggtatt
gaagaggagggacatcgaacggagtctatcgtgatcaagtccacctccaagacagatctt
tccgcgaattag

DBGET integrated database retrieval system