KEGG   Leishmania braziliensis: LBRM_20_3990Help
Entry
LBRM_20_3990      CDS       T01113                                 

Gene name
TOR2
Definition
putative target of rapamycin (TOR) kinase 2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lbz  Leishmania braziliensis
Brite
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   LBRM_20_3990 (TOR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34a:1534873..1542186
Genome map
AA seq 2437 aa AA seqDB search
MSSVDSERLAASIRALASSRDERIAFVTEGVKQAKELQGKSVQEYEMVVSSLLMCLESFE
VVHGTSVDVFCELTVLDILLSLDLSVIQLSQCNSYLRLCLMAVNEIPVAVAAAKTFAQTL
SYSMTTDFVRTQIGETLEWIALSDAKSQPRRICSILVLTEVALRIPMVILPRLSEVFDRV
WDCLAEHDEEVRSRALSLFTLCAKLLVNRPATIRAETCDTLMSHLKANLVSKSKDKRIAG
LLAFEPIVINSIGTSSVRYEDLSALLAPYIMGDGANVNADISGLLCRCLVVLCRFSAPQF
VTKQLKDTVRFALDSINRNTGRNTAFDMLSEIIPIVGKAEFAPFVEDTCEVIKNIFVQSP
SPCWKALQCFCIICRDCRPSKMETYVDSCIESVFGWGLSAELIECMRTIIESSGAQYRAK
LEESLLDMISVTLCGLPFRQQINAPRVSGSSADVGASEYQISVALNALKQFGFSNSELMG
DFLRVSVLPFIDNSSVAVRNAAIYTIVKLLIPPGEKGDLSIARRMCVNTIITRMLVVGLS
DPNPVVRHTILSAFTENFYPYLSEQQYLFRFYSALGDESINCRVAATEQLCQMIRYDPSH
ILPALREEMVVILNFITSTFNMDTVQNGFRLLAAIATRAPQIVVNFTDGICEALLPYFST
LSARSGILLSFLHCCTAVAAAIRKFGSTLLSSQREVALVCELLESLPTDRSYHVIRLACL
RFLSATLAPLMEGTSPYVLYPRLFQQLCTVLHKTEESIDIRLEALRCIGVIGALDSHVFQ
SVNLSEEKADGVSAVVVDRVTHVKCCRIVLRSVAALLDPESKRSAGAREGLLRTGVQTML
NIFEHVPCSKSEISLVIGPLARVIRQLPGGRLFATVLFEFCNIIRYAGVMVLNDASEIYS
VFDSVWEFQVNYRFLAVRMLSFVANFEGSGNRHYGQQHSRILPQLFDTLNRTELRPDLKY
AVLEYIVRHIDALQPCTEAVVDNLLGAIQNPENPLDFVNHCVVALKEVCLKLYVDELVGA
IVRCLLTCLSVDLARKTRGRDSVALCNNIMGVFCVLIEEMQGDFLKHSTYIIQALKNYRI
TNTEFGVMNNRVATGLRCARSPASIQHQNAEVAALLKTCESVVMKSMSRVGEVWSYANLN
DDNANSVLAEDRTMPINEQRLINPMKVVPLTKEEWVKWADQFAITLLQESPFQVFRCTAV
PIGINAAPLVEKSTQFVQDTLQIAFRSMWNYASSALQAAITDFFRQSFRQAMMSTAVPGE
VVTTLLGIVEYMDHVGEALFISYNDLSECAWNRGMLAKALFWREAAYRDDPVGTVESLIS
LYSELHMVDSSVGILNMASEEQRRSLLQTSLVKLARYTEALKLTQKELDLDAASTEAKSS
ENVSKGYGYKNGNRDWSRMLHYTTNSDPTTSFSRTEESGHDHRVEVNARLMLCLSELGEY
DKVLKQWGIMVDNYKDRVAESDEMHIFFFVSQYAADASIRLQSWDTLEYILNWLPPDMVL
YHVSKAALQVVRGNYDDALVSVTNGRKVLLEGLTSLLHESYARAYEGLVVAQQLTEVEEV
IVAKQTQKALNSTAHIPHLCHLWEQRIRTMNATVPTWKQVLGTRGLLISPHEDVKTRLQF
TKLCRQENARQLEKFTLAELLGFANPTLEQLTSRNANPRVVMQYISFLSDTNALGPDSAF
GTESDLIKKMIDVHTKAENSTVLARAYTRLGSKVGLIESVECFKTATLYDPQWFLAWSKW
AEANAQLLHTDKGDRTCRNAIEGFIRSIQLGTSDSTLIQDVLKLLTLWSNHCDCDHNLKE
LRERVFDVPSRVWHLVVPQLVARLDIGSDDSCRLVADVLTNVGYDYPHTLVYPLNLCTMS
DSERRKRYSNEVLSKLQERYPVIVLQGRLMIDELIRVSALIYEQWYDKLEEAATAFFGRR
SKEEMVRTLLPINETLTKVPETVVESEFLSRYSKRLTEAWEWLRSYSSTRNTGDVQSAWK
LYHSVYGDIDKQIKASDTLQLQFCSPKLFEARNLSIGIPDARPVREESVAKVHCFQKDLI
VITSKQRPKRIGIITDGGKSQKFLLKGREDLRLDERVMQLFSLVNILMQSDSRTSKNLGF
QIQRYSVTPLKDNVGIIGWVDGCDTLHEVVKHFRERKLIPVELEMRMLNQIITFDNTKAY
DYLTIMSKVEVVEFLSDHTSGQDIRKSMWNTSPNCEVWYDRRRMYTTSLANMSIVGYILG
LGDRHPNNIMLQRASGLVVHIDFGDCFEVAMTRDKFPEKVPFRLTRMLRSALDVSGVDGA
FRACSETVMCVLREGSHSVLALLEAFIQDPLISWRLINRQGQEPQSSNDHKTIEQQVNIA
NMNKATSTAEEESICESIEQRNTGSFSIAKHLFGEEVDVVHQGVFLFNRLSSKLKGQDFI
AAGTEPLDPRTQVGQLIDEATDVINVAQSWSGWYPFW
NT seq 7314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgttgactcggagagactggcggcctccatccgcgcactcgccagcagccgc
gacgagcgcatcgccttcgtgacagagggggtgaagcaggcgaaggagttgcagggcaaa
agtgtgcaggagtatgaaatggtcgtttcctcactgctgatgtgcctggagagctttgag
gtggtgcacggcacgtcggttgatgtgttttgcgaactcactgtgcttgacattctgctg
agcctagacctatccgtcatccagctgtcgcagtgcaacagctacttgcgcctttgtctc
atggcggtgaatgagattcccgtcgctgttgcagccgccaagacgttcgcgcagacgctc
agctacagcatgacaacagactttgtgcggactcaaatcggagagacgctcgagtggatt
gcgctgtccgacgccaagtcacagcctcgtcgtatttgtagcattttggtgctcacggag
gtggcgttgcgcataccaatggtgattctgccgcgcctctctgaggtgtttgacagggtt
tgggattgcctggcggagcacgatgaggaggtccgctcgcgtgctttgagtctcttcacg
ctatgcgcaaagctgttggtcaaccgccccgccactatccgtgctgaaacctgcgacaca
ttgatgtcacacctgaaagccaacctcgtctcaaaatcgaaggacaaacgcattgccggt
cttcttgcattcgagcctatcgtgatcaactcgatcggcaccagcagcgttcgttacgaa
gatctctccgcccttctagccccgtacatcatgggagacggagcgaacgtcaacgccgac
attagcgggctcctgtgccgctgtctggtggtgctctgccgcttcagcgcaccacagttt
gtcaccaaacagctcaaggacaccgtgcgctttgcgctggactccatcaaccgcaacaca
gggcggaacaccgccttcgacatgctctcagagatcatcccgattgtaggcaaggcagag
tttgcgccgtttgtggaggacacgtgtgaagttatcaagaacattttcgtgcaatccccg
agcccgtgctggaaggcgctgcagtgcttctgtataatttgcagagattgcaggccgtcc
aagatggagacgtatgtagactcgtgcatcgaaagcgtctttgggtggggactttccgcg
gagctgatcgagtgcatgcgcactatcatcgagtcatctggcgcccagtaccgcgcaaaa
ctggaagagtcactgctggacatgatttccgtcacactatgcggtctgccatttcggcag
cagatcaacgcaccgcgcgttagtgggagctctgcggatgttggcgcctccgagtatcag
atctctgtcgccctcaacgccctcaaacagttcggtttctccaactcggagctcatgggt
gactttctgcgagtctcggtgctgcctttcatcgacaacagcagcgtcgctgtgcgtaac
gcggccatctataccattgtaaagctcctcattccccctggtgagaaaggcgacctcagc
atcgcgcggcgcatgtgcgtaaacaccatcattacgcgcatgctggttgtcgggttgtcg
gaccccaaccccgtggtgcgtcataccattctaagtgcttttacagagaacttttatcca
taccttagtgagcagcagtatctctttcgtttctactcggccctgggtgacgagtcaatc
aactgtcgcgtggcggcgacagagcagctgtgccagatgatccgctacgacccatctcac
attctacctgcgctacgtgaggaaatggtcgtgattctgaacttcatcacgtctaccttc
aatatggacaccgtccaaaacggcttccgcctcctcgccgcaatcgcaacgcgcgcgccg
cagatcgtggtgaacttcacggacgggatttgcgaggcgctcctgccgtactttagcact
ctttctgcccgttccggcattctcttgtcgttcctgcactgttgcacagccgtcgcggcg
gcgatcaggaagtttggcagcacccttctctcctcccaacgggaggttgccctcgtgtgc
gagctgctggaaagcttgccgactgaccggtcttaccacgtcatccgacttgcttgcctc
cgcttcctctcggcaaccctggcgccgctcatggaaggcacctcgccgtacgtgctgtac
cctcggcttttccagcaactctgcacggtgctgcacaaaacagaagagagcattgacatt
cgtcttgaagcgctgcggtgcattggagtcatcggtgcgctggactcacacgtgttccag
tccgtcaatctcagcgaggagaaggcggatggggtgagcgccgttgtggtggaccgtgtg
acccacgtgaagtgctgccgtattgtactccgctccgtggcagcgctgctggaccccgag
agtaagcgctccgccggagcgcgggaaggactgctgcgcaccggtgtgcagacgatgctg
aacatttttgagcacgtgccgtgctccaagagtgaaattagtctggtgattgggcccctg
gcccgcgtcatccgtcagctgcctggcggccgcctctttgccaccgtgctcttcgagttc
tgcaacatcatccgctacgccggtgtgatggtactcaacgacgcgagtgagatttacagc
gtctttgacagcgtctgggagtttcaggtaaactaccggtttctggccgtgcgcatgctc
tcgtttgtcgccaacttcgagggctccggcaatcggcactatggccagcagcattcacgc
atcctgcctcaactcttcgatacgcttaaccgtactgaactgcgccccgacctcaagtac
gccgtgcttgaatacattgtgcgccacatcgacgcactgcaaccgtgcacggaggcggtg
gtggataacctcctcggcgccatccagaacccagagaatccgctcgactttgtgaaccac
tgcgttgtggctcttaaggaggtctgcctcaaactgtatgtggatgagcttgtcggcgcc
atcgtacgctgcctgctgacatgcctctccgtcgacctcgcgcgcaagacacgtggacgt
gacagcgttgcgctttgtaacaacatcatgggcgtattttgcgttttgatcgaggagatg
cagggcgatttcctcaagcactcgacctacatcattcaagctttgaagaattaccgcatc
accaacactgagtttggagtaatgaacaaccgcgtcgccaccggtctccgctgtgcacgc
agcccagcctcgatccagcaccaaaacgcggaggtggcagcgctgctgaagacgtgtgaa
tccgtcgtgatgaagagcatgtctcgcgtgggcgaggtctggagctacgcgaacctcaac
gacgacaacgccaattccgtgctggcagaggaccgtaccatgcccatcaacgagcagcgc
ctcatcaaccccatgaaggttgtgcccctcacaaaggaagagtgggtcaagtgggcagac
cagttcgccatcacgctgctgcaagagtccccgtttcaggtcttccgctgcacggcagta
cctatcggcatcaacgcagctccgctagtggagaaatcgacgcagtttgttcaagacacg
ctgcagatcgctttccgctccatgtggaattacgcaagctcggcactgcaagccgctatc
acggactttttccggcagtcgtttcgtcaagcgatgatgtcgactgctgtcccgggcgaa
gtggtgacgacgctgcttggtattgtggagtacatggaccacgttggggaagccttgttc
atctcgtacaatgacctttccgagtgcgcgtggaaccgtgggatgttggccaaggcactt
ttctggcgcgaggctgcctaccgcgacgatcccgtcggcactgtagagtcgctcatctcc
ctctacagtgaactgcacatggtggactcctcagttggcatcttgaacatggcgagcgag
gagcagcgacgcagcctgctccagacgagtctggtgaagctcgctcgctacacggaggct
ctcaagctgacgcagaaggagctagacctggacgctgcctcgacggaagcgaaaagctcg
gagaacgtctccaagggctacggatacaaaaatggcaaccgcgactggtctcgcatgctg
cactacaccaccaacagcgaccccacaacatcgttctcaaggacggaggaaagcggccac
gaccaccgcgttgaggtcaacgcgcgactgatgttgtgcctgagcgagcttggcgagtac
gacaaggtgctgaagcagtggggtatcatggtcgacaactataaggaccgcgtggcagag
tcagacgagatgcacatatttttctttgtctcgcagtacgccgcagatgcatcgatccgg
ttgcagtcgtgggacacgctcgagtacatcctgaactggttaccgcctgacatggttctc
taccacgtgtcgaaggcagcattacaagtggtgcgcggcaactacgacgacgcgctcgtc
tccgtgacgaacggacgcaaggttctgctggaggggctgacaagcctgctgcacgagtcg
tatgcgcgcgcctacgaggggctggtggtggcgcagcagctgacagaggtggaagaggtc
atcgttgcgaagcagacgcagaaggcgctcaactccaccgcacacataccgcatctctgc
cacctctgggagcagcgaattcgaacgatgaatgcgacagtgccgacatggaagcaggtg
ctgggaaccagagggcttctcatctcccctcatgaggacgtgaagacgcgcctccagttc
accaagctctgtcggcaggagaacgcccgacaactggagaagttcacgctggccgagctc
ctcggcttcgcaaacccaaccctggaacaactcacgagccgcaatgcgaacccgcgcgtg
gtgatgcagtacatctcattcctctccgacaccaacgcacttggccccgacagcgccttt
ggcaccgagagtgacctcatcaagaagatgattgacgtgcacaccaaggcggagaactca
actgtgttggcgcgggcctacacgcgcctcggcagcaaggtcggccttatcgagtccgtg
gagtgtttcaagactgccaccctgtacgatccacagtggtttctggcgtggagtaagtgg
gctgaggcgaacgcgcagttgctccacacggacaagggcgatagaacgtgccgcaacgct
atcgaagggtttatccgcagcattcagcttgggacgtccgattcgacgctcatccaagac
gtgctgaagctcctaacgctctggtcgaaccactgcgactgtgaccacaacttgaaggag
ctgcgcgagcgcgtctttgatgtgccgtcgcgcgtgtggcatcttgtggtaccgcagctg
gtcgcccggctcgacatcggctccgacgatagctgccggcttgtggcggatgtcctgacc
aacgtgggctacgactacccgcacaccttggtgtacccgctgaatctgtgcaccatgtcg
gactcggagcgacgtaagaggtactcaaatgaggtgctgagtaagctgcaggagcgatat
ccggtgattgtgctgcaaggccgtctcatgatcgacgaactcatccgtgtttcagccctc
atctacgagcagtggtacgacaagctggaggaagcggcgactgccttctttggccgccgc
agtaaggaggaaatggtgcgcacgctacttccgattaatgagactttgacgaaggtgcca
gagacggtggtggagtctgagtttttgtccaggtacagcaagcggctgaccgaggcgtgg
gagtggctgcggtcgtactcgtcaacgcgtaacactggcgacgttcaatcggcatggaag
ctgtaccacagcgtgtacggcgatattgacaaacaaatcaaagcgagcgacacgctacag
ctccagttctgcagcccaaagctgtttgaagcacgtaacctctccatcgggatccccgac
gcgcggccagtccgcgaggagtcagtagcgaaggttcattgctttcagaaggacctcatt
gtcattacaagtaagcagcggccgaagcggatcggtatcatcacggacgggggaaagtcg
cagaagttcctcctcaaagggcgcgaggatcttcgcttggacgagcgcgtcatgcagctc
ttctcgctagtcaacatcctcatgcaatctgactcgaggacgagcaagaacttaggcttc
cagatccagcgctactccgttacgccgttgaaggacaacgtcggcatcattggctgggtc
gacggatgcgacacattgcacgaggtcgtgaagcactttcgcgagcgcaaattgatcccg
gtggaactggagatgcgcatgctgaaccagatcatcacctttgacaacaccaaggcgtac
gactacctgaccatcatgtcgaaggtagaggtcgtggagttcctctccgatcacacctcc
gggcaggatattcgcaagtccatgtggaacacgtcgccgaactgcgaggtctggtacgat
cgccgccgcatgtacacaacgtccttggcaaacatgagcatcgtgggctacatcctcggt
ctcggtgaccgtcatccgaacaacattatgctgcagcgcgcatcgggattggtggtgcac
atagactttggtgactgctttgaggtggccatgacgcgcgacaagttccccgagaaggta
ccttttcgattgacgcgcatgctgcgcagcgcgctcgacgtgtcgggcgtcgacggggcg
tttcgggcatgctcggagactgtgatgtgcgtgctgcgcgaaggcagtcacagtgtgctg
gctctcctcgaggcattcattcaagacccgctcatctcgtggcgcctcatcaacagacag
ggacaggagcctcagtcatcgaacgaccacaagaccatcgagcagcaggtgaatattgcc
aacatgaacaaagccacgtcgacggcggaagaagagtccatctgtgagtcaatcgaacaa
cgcaataccggctcctttagcatcgcaaagcacttgtttggggaggaggtggatgtcgtg
catcaaggtgtgttcctcttcaaccgcctcagctccaagctcaaagggcaggatttcatc
gcggccggcacggaaccactcgacccgcgtacgcaggtagggcagcttatcgacgaagcc
acagacgtcatcaacgtggctcagtcgtggtcgggatggtacccgttctggtag

DBGET integrated database retrieval system