KEGG   Leishmania braziliensis: LBRM_20_4060Help
Entry
LBRM_20_4060      CDS       T01113                                 

Definition
putative 1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lbz  Leishmania braziliensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBRM_20_4060
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     LBRM_20_4060
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     LBRM_20_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34a:1554275..1555117
Genome map
AA seq 280 aa AA seqDB search
MEGISEEQRLREEAEIRERDRKRQQEKEEYERRLTEERAEEDRKRREAQQLRLEEEKRKK
RQEEEWKRLGPDVIQDLPPVPPPVSEEGALEMWYLDDETSQPPLSTASLKPGRKVSAPAV
TMKALRELGVVLFRISMSDFSVVKQIIKEREYKHTDEVKISQTAKDDSFLERWYQEHYTE
DEQFRVVMDGSFYLDIRSKQDEWIRVHLKAGDLVVLPAGMYHRATLDEDDYVALYRGFQD
APRFVPVKRSDSRADSNRVRLAYLMSLKKGDVATQNGFLP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcatttcagaggagcagcggctacgcgaagaggccgagattcgcgagcgtgac
cgtaaacggcagcaagagaaggaagaatacgagcgccgcctcacagaggaaagggcagag
gaggaccgcaagcgtcgcgaggcgcaacagctgcgcctcgaggaggaaaagcgcaaaaag
cggcaggaggaggagtggaagcgtctcggcccagatgtaattcaggacctgccgccggtg
ccgccgccggtgtctgaggagggagcgcttgagatgtggtaccttgacgacgagacgtct
cagcctccgctgagcaccgccagcctcaagcctgggcgaaaggtcagcgctcctgcggtg
accatgaaggcgttacgtgagctgggcgtcgtccttttccgcatcagcatgagcgacttc
tctgtggtgaagcagatcatcaaggaacgagaatacaagcacaccgacgaggttaaaatc
tcacagaccgccaaggatgacagctttctcgagcgttggtatcaagagcactacaccgaa
gacgagcagtttcgtgttgtgatggacggctccttctacctggatatacgatcgaagcaa
gacgagtggatccgggtccacctgaaagcaggtgatcttgtcgtgctccctgccggcatg
taccaccgcgccactctcgatgaagacgattacgtagccctctatcgtggcttccaagac
gcaccccgctttgtacccgtcaagcgatccgacagtcgcgcggactccaatcgggtgcgg
ctggcgtacttgatgagtttgaagaagggcgacgtcgccacacagaacggatttcttcca
tga

DBGET integrated database retrieval system