KEGG   Leishmania braziliensis: LBRM_20_5150Help
Entry
LBRM_20_5150      CDS       T01113                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lbz  Leishmania braziliensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lbz00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20_and_34b:307576..308610
Genome map
AA seq 344 aa AA seqDB search
MTECWYIPEEVADRREENRLSPNVPGSYEALSEARVFFRHFDPKEVSDDIEGFIQPLLKK
LNYHSYDVVNLSPATLGDEKFEALAEQHFMEHTHEDDEVRLILEGQGYFDVRDANDKWIR
LLSKPGDCIVLPAGMYHRFTTDHSKCIKTLRIFKEAPRWIALNRGPETEEKPARKEYLAR
LHAPAETAVGAANSHTIFSLHYPLKLDAELTVITKRLLEQHSKQPLALMIFLTGSTDPTT
GASWCPDCIPAKPQVAQRFAELQGKYGEERAIFLQLPVERAGYLGNPEYPYRKHPTLQLA
SVPTLLVLTPTKDAKEKGDVQWYDRLEVKMRTCDIDKADVLSLE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacagagtgctggtacatccccgaggaggtggcggatcgccgcgaggagaaccgtctc
tcaccaaacgtgcccggcagctacgaggcgcttagtgaggcgagggttttctttcgtcac
ttcgacccgaaagaagtgagtgacgacattgagggcttcatccagccgcttctcaagaag
ctcaactaccacagctacgacgtcgtaaacctcagcccagccaccctcggggacgagaag
tttgaggctctggcggagcagcactttatggagcacactcacgaggacgatgaagtgcgg
ctaattctcgagggacaaggctactttgacgtgcgcgatgccaacgacaagtggattcga
ttactgtcgaaacctggcgattgcatcgtcttgccagctggcatgtaccatcgcttcacg
acagaccacagcaagtgcatcaagaccctgcgcatcttcaaggaggcgccccggtggatc
gcgctgaaccgcggcccagagacggaggagaagccggcgcgcaaggagtacctcgctcgc
ctgcacgcccccgccgagacagctgtcggtgccgccaacagccatacgatcttctctctg
cactacccgctgaagctggatgcggagctcactgtcatcacgaagcggctgctcgagcaa
cacagtaagcagccgcttgctctcatgatcttcctgaccggctccaccgacccaacgacc
ggggcatcatggtgcccggactgcatcccagcgaagccgcaggtcgcacagcgctttgca
gagctccaaggcaagtacggtgaggagcgcgccatcttcctacagcttccagttgagcgc
gccggctatcttggcaacccggagtatccctaccgcaagcacccgactctgcagctagcg
agtgtgccgacgctgctcgttctgacaccgaccaaggacgccaaggaaaagggcgacgtg
cagtggtacgaccgactcgaggtcaagatgcgcacctgtgacattgacaaggcagatgtg
ctgagcctcgagtag

DBGET integrated database retrieval system