KEGG   Leishmania braziliensis: LBRM_21_0610Help
Entry
LBRM_21_0610      CDS       T01113                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase precursorlike protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00010  Glycolysis / Gluconeogenesis
lbz00020  Citrate cycle (TCA cycle)
lbz00620  Pyruvate metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_21_0610
   00020 Citrate cycle (TCA cycle)
    LBRM_21_0610
   00620 Pyruvate metabolism
    LBRM_21_0610
Enzymes [BR:lbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBRM_21_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl E3_binding HlyD_3
Motif
Other DBs
NCBI-GeneID: 5415326
NCBI-ProteinID: XP_001564770
UniProt: A4HBQ2
Position
21:complement(168270..169058)
Genome map
AA seq 262 aa AA seqDB search
MMRRTLLWLVNFEPVFMPALSPSMERGTVVEWKKKVGDVVNENDVFCTIQTDKAVVDYTN
TFESGYLAKIYCENGQSAPVAKTIAVMVSDAADVEKASNYYPEDAATAPATAPAAADAAQ
DPPVSSAAPAKHYGGSIDAAVAASGPSVTRIVAGLEPSALAGIAPSGKGGRFLKSDFSDQ
PGFKYSDTAPARATRKEVPAAAAGDTSKTAAKSVAGTAVSGSIYDVVLKPGPAYKSVSDT
ALLNKLIRAMYVPKPNANKAAK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgacgcacgctgctctggctcgtgaatttcgagcccgtcttcatgccggctctc
tccccgtcgatggagaggggtaccgtggtcgagtggaagaagaaggtaggcgatgttgtg
aatgagaatgatgtcttctgcaccatccagacggacaaggctgtagtggactacacgaat
accttcgagagcggctacctcgccaagatctactgcgagaacggccagtctgcccctgtg
gccaagacgatcgcggttatggtgagcgacgccgccgatgtggagaaggcctctaactac
taccctgaagatgctgctactgcccctgctactgcccctgctgctgctgatgctgcgcag
gatcccccggtttcctcggccgcacctgccaagcattacggtggctcgattgacgcggcg
gtggcggctagcggcccgagcgtgacccgcattgttgctggtctggagcctagcgctcta
gccggcatcgctccctctggtaaaggcggccgtttcctgaagtccgatttttctgatcag
cccggcttcaaatacagcgacactgcgccggcgcgcgcgacgcggaaggaagttccggct
gctgccgctggtgacacgagtaagacagctgcgaagtctgtcgctgggacagcggtaagt
gggagtatttacgacgttgtgctcaagcccggtcctgcgtacaagagcgtcagtgatacc
gccctgctgaacaagctcatccgcgccatgtacgttccgaagccgaatgcaaataaggcc
gccaagtaa

DBGET integrated database retrieval system