KEGG   Leishmania braziliensis: LBRM_21_1410Help
Entry
LBRM_21_1410      CDS       T01113                                 

Definition
putative thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lbz  Leishmania braziliensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lbz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21:complement(463446..464297)
Genome map
AA seq 283 aa AA seqDB search
MFRGRIELIIGPMFAGKTTELMRRVKREIHARHSCFVIKYSKDTRYDEHNVASHDQLMLR
AQAAVSQLKEVQDTWQRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPF
GQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVKVEQQELIGGADMYIATCRECYTKQ
QLPSIEEMRTQQMAIKEVEKRYLRMAEKANPSPQTPEKPAGGWGTKSKVATLTTVTIEGA
AASGASTNMKASRDLDEMTDFVTDPSKYQRLEPACTALAESSE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcggtcgtatagagctcatcatcggcccgatgttcgccggcaagacaacagag
ctaatgcgccgcgtcaaacgcgagatccacgctcgtcacagctgctttgtcatcaagtac
tccaaggacactcgctacgatgagcacaacgtcgcctcgcatgaccagctgatgctacgg
gcgcaggcagccgtctcgcagctgaaggaggttcaggacacgtggcagaggttcgacgta
ctggcgattgacgagggccagttcttctcggacctggtagacttctgcaacaccgctgct
gacgcaggcaaggtcgtcatggtgtcggccctcgatggcgattaccggcgcaaaccgttt
gggcagatctgcgagctcgtcccgtattgcgaggcggtggataagctaacggcggtgtgc
atgatgtgccacgagcagccagcctgctttactcggcgcaccgtcaaggtggagcagcag
gagctcattggtggcgcagacatgtacattgccacctgccgcgagtgctacacgaagcag
cagctgccttcgattgaggaaatgcggacgcagcagatggccatcaaggaggtcgagaag
cgctacctccgcatggcagagaaggcgaaccccagtccccagacacccgagaagccggcc
ggcgggtggggcactaagagcaaggtcgcgacgttgacgacggtgacaatagagggtgcg
gctgcgtctggggcgtcgactaacatgaaagcgagtcgggacctggacgagatgacggac
ttcgtcactgacccatccaagtaccaacgcctggagcctgcatgcacagcgctagccgag
tcctcagagtaa

DBGET integrated database retrieval system