KEGG   Leishmania braziliensis: LBRM_22_1590Help
Entry
LBRM_22_1590      CDS       T01113                                 

Definition
putative phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lbz  Leishmania braziliensis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LBRM_22_1590
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LBRM_22_1590
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LBRM_22_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22:636617..638755
Genome map
AA seq 712 aa AA seqDB search
MGALCSKVDTFDKRATKHIPALTALTDNYFSIHNPNENESALFFASLRVALHSMLHCSKE
EVNDVLISSCSCSVSTSAALDRYLSRNTFKVAPDPTTAKIMQVWMAYDKDNSGDLSYSEM
KRLVGGLNFSKGLTEEILKPFKDDKRHTITFADFTRVYSDAVSFKELGYVFKGLAGDRET
ISRDTFARFLFDVQGENCDAETLNEKLALMGCVDTDGITEKNFVAYLMSPHFDSAMEQKK
LEEVYHDMDQTISCYFINTSHNTYLTGDQLTSKSSPEMYKRVLLDGCRCVELDCWNGPHG
EPIVHHGYTPTSRIAFRDCITVIRQHAFTASPYPVILSLEVHASVAQQDRMAEILEKELG
SLLFQPSWGAGVRPTILFSPNNLKYKILIKTKRGDFSPGELGIDKYDDAETDSVATTGSI
DYLAMKAARKKAKKDVIKVSEKLSAIVSIEASGYKGVKDLSYLLDKQPYHCSSFSEGKVE
AIARENRDALVRINDTYLSRTYPAGSRFDSSNYNPHLYWECGCHMVSINWQSTTTLGWRL
NRGFFLDNGLCGYLLKPDYLRPITSSNAAVAEKSRLLTVEVISGFSLPKPPKASKSDISD
PFVTMFLEGPGVDCTPMSTHTIHNNGFHPVWRGAGQTERTWTVHRWSMTTLVLQIHDRNK
YSPSELLADAVIPLRVLRKGFRKVPLNDHAGYNIPGSSLVCRIDYTDEPGSF
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgggagccctctgcagcaaagtggacactttcgacaagcgcgccaccaagcacattccg
gcactcacggcgcttacagacaactacttctccatccacaacccaaacgagaatgagtct
gccctctttttcgcctcgctgcgagtggcgctccacagcatgctacattgcagtaaggaa
gaggtgaacgatgtcttaatctcttcgtgcagctgcagcgtgagcacaagtgctgcgctt
gataggtatctgtccaggaacacattcaaggtggcaccggatcccacgactgccaagatc
atgcaggtgtggatggcgtacgacaaagacaacagcggcgacttgagctactcggagatg
aagcgcctggtgggggggctcaacttctcgaagggtttgactgaagaaatcctgaaaccc
ttcaaggacgacaagcgccatacgatcaccttcgccgattttacgagagtgtactcggac
gccgtgagcttcaaggagcttggctacgtcttcaagggtttagcaggcgaccgggagacc
atctcgcgcgatactttcgccaggtttctcttcgatgtccaaggcgagaactgcgatgcc
gagacgctcaacgagaagctcgctctcatgggctgcgtcgacacggacggcatcactgag
aagaacttcgttgcgtatcttatgagcccccacttcgactccgcgatggagcagaagaag
ctcgaggaggtctaccacgacatggaccagacgatctcctgctacttcatcaacacttca
cacaacacatacctcactggcgaccagctcacgagcaagtcttccccagagatgtataaa
agggtacttctcgacgggtgccggtgcgtggagctcgattgctggaacggccctcatggt
gagccgattgtgcaccacggctacacccccacctctcgcatcgccttcagagattgcatt
acagtgattcgccagcacgccttcaccgcttcgccataccccgtgatactctcgctggag
gtgcacgcttcggtggctcagcaggataggatggcggagattctcgaaaaagaactgggc
tcgctgctcttccaaccttcgtggggcgccggtgtgaggcccaccatactcttctcgccc
aacaacttgaaatacaaaatcctcataaagacaaagcgcggtgatttctctcctggtgag
ttgggcatcgacaaatatgacgacgctgagacggactcggtggcgaccacaggcagcatt
gactacctggcgatgaaggcggctcgtaagaaggccaagaaggatgtgatcaaggtgtcg
gagaagctgtcagccattgtctccattgaggccagtgggtacaagggcgtcaaggactta
tcatacctgttggacaagcagccgtaccactgctcctcgttctcagagggaaaagtggag
gccatcgcgcgtgagaaccgcgacgcactggtgcgcatcaacgacacgtacctcagccga
acctatcccgctggctcgcgcttcgacagcagcaactacaatccgcacctttactgggag
tgtgggtgccatatggtgtctattaactggcagtccactaccaccttgggctggcgcctc
aaccgcggctttttcctcgacaacggcctctgcgggtacctcctgaagccggactacctg
cggcccataaccagctccaatgcagcggtggcggagaagtcgcggctgctaacagtggag
gtgatttcgggcttctcgcttccgaagccaccgaaggcaagcaagtcagacatttctgat
ccgtttgtgacaatgtttctcgagggccctggcgtggactgcacgccaatgagcacgcac
acgatccacaacaacggctttcaccccgtctggcgcggtgcggggcaaacggaacggaca
tggacggtgcaccggtggtccatgacaacccttgtgctccagatccacgaccgcaataag
tacagcccatctgagctgctcgcagatgccgtcattcctctgcgtgtgcttcgcaaagga
ttccgcaaggtgcccctgaatgaccacgccggctacaacatacccggcagctctcttgtg
tgccgcatcgactatacggatgagccagggtcgttttaa

DBGET integrated database retrieval system