KEGG   Leishmania braziliensis: LBRM_23_0460Help
Entry
LBRM_23_0460      CDS       T01113                                 

Definition
(RefSeq) aldose 1-epimerase-like protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00010  Glycolysis / Gluconeogenesis
lbz00052  Galactose metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_23_0460
   00052 Galactose metabolism
    LBRM_23_0460
Enzymes [BR:lbz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LBRM_23_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 5415692
NCBI-ProteinID: XP_001565118
UniProt: A4HCQ7
Position
23:153569..154795
Genome map
AA seq 408 aa AA seqDB search
MFGSQPVPATATSAHGPQVDPFGESFAITLSSEHLRVQLLSHGAALNSVKVRKPHAAASG
SAAAEQDGEWMDVCLGYTNPEEAFSTDAVIGHTIGRYAGRIANGELEVKNVPYTLAKNCG
PHNLHGGPVGFQNKEWKYLLSDGKDETSVAFHLVSPHMDQGFPGELFVTATYSIIKSAPA
PTLKYVLQASLSDNTSVDMTVINLTNHAYWNLNGVPRPAEADAVAPLPRSITNHYLQLQS
RYFAVTDESSIPNGDMRPVEGTLHDYSELRCIAEGMEATKEEGRDGGGYDDPVALETWDS
TLREAALLYSPATKLRMRVCTTNPVIVVYTANALPADASGAKGQRFQQHSAICLECQYFP
NSPNVPAFPSTALKKGEVYKETTTHEFQFMNADITPEERQQRHHYAPS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcagccaacctgtcccggcaacggcgacgtccgcgcacggcccccaagtcgat
ccgtttggtgagtcctttgccataacactaagctcggagcatctgcgcgtgcagctgcta
tcgcatggtgcggcgctcaactctgtgaaggtgcgcaagccacacgccgcagcatcaggc
agcgctgctgcggagcaggatggggagtggatggatgtgtgccttggctacacaaatcct
gaggaagccttcagcacggacgcggtgatcggtcacaccattggacgatacgccgggcgc
atcgccaatggcgagctcgaggtgaaaaatgtgccgtacacactcgccaagaattgcggt
ccgcacaacctccacggcggcccggtcggatttcaaaataaggagtggaagtacctcttg
tcagacggcaaggacgagacgagtgttgcttttcacctcgtctcaccgcacatggaccag
ggcttccccggtgagctcttcgtgacggccacctacagcatcatcaagtcagccccggcc
cccaccctcaagtacgtccttcaggcctcgctgtctgacaacacgtcagtagacatgaca
gtgatcaacctgactaaccacgcctactggaacctcaacggtgttccgcggccagcagag
gcggatgccgtggcaccgctgccgcgaagcatcacaaaccattacctgcagttgcagtcc
aggtacttcgctgtcaccgatgaatcgagcatcccgaatggcgacatgcgtcctgtcgag
ggtaccctgcacgactactcggagctgcgctgcattgccgaaggaatggaggcgacaaag
gaggagggccgtgacggcggcggctacgacgacccggtcgccctggagacgtgggactcg
actctgcgggaggcagcgctgctgtacagtccagcgacgaagctacgcatgcgggtgtgc
accacgaatccagtcattgtcgtctacacggcgaacgccctgccggccgacgcttctggc
gcaaagggccagcgcttccagcaacacagtgccatctgcttggagtgccagtacttcccg
aacagccccaatgtgccagcgttcccatcgacggcgttgaagaagggcgaggtgtacaag
gagacgacgacgcacgagttccagttcatgaacgcagacatcactccagaggaaaggcag
caacgtcatcactacgctccgtcttag

DBGET integrated database retrieval system