KEGG   Leishmania braziliensis: LBRM_23_0460Help
Entry
LBRM_23_0460      CDS       T01113                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lbz  Leishmania braziliensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lbz00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbz00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23:153569..154795
Genome map
AA seq 408 aa AA seqDB search
MFGSQPVPATATSAHGPQVDPFGESFAITLSSEHLRVQLLSHGAALNSVKVRKPHAAASG
SAAAEQDGEWMDVCLGYTNPEEAFSTDAVIGHTIGRYAGRIANGELEVKNVPYTLAKNCG
PHNLHGGPVGFQNKEWKYLLSDGKDETSVAFHLVSPHMDQGFPGELFVTATYSIIKSAPA
PTLKYVLQASLSDNTSVDMTVINLTNHAYWNLNGVPRPAEADAVAPLPRSITNHYLQLQS
RYFAVTDESSIPNGDMRPVEGTLHDYSELRCIAEGMEATKEEGRDGGGYDDPVALETWDS
TLREAALLYSPATKLRMRVCTTNPVIVVYTANALPADASGAKGQRFQQHSAICLECQYFP
NSPNVPAFPSTALKKGEVYKETTTHEFQFMNADITPEERQQRHHYAPS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcagccaacctgtcccggcaacggcgacgtccgcgcacggcccccaagtcgat
ccgtttggtgagtcctttgccataacactaagctcggagcatctgcgcgtgcagctgcta
tcgcatggtgcggcgctcaactctgtgaaggtgcgcaagccacacgccgcagcatcaggc
agcgctgctgcggagcaggatggggagtggatggatgtgtgccttggctacacaaatcct
gaggaagccttcagcacggacgcggtgatcggtcacaccattggacgatacgccgggcgc
atcgccaatggcgagctcgaggtgaaaaatgtgccgtacacactcgccaagaattgcggt
ccgcacaacctccacggcggcccggtcggatttcaaaataaggagtggaagtacctcttg
tcagacggcaaggacgagacgagtgttgcttttcacctcgtctcaccgcacatggaccag
ggcttccccggtgagctcttcgtgacggccacctacagcatcatcaagtcagccccggcc
cccaccctcaagtacgtccttcaggcctcgctgtctgacaacacgtcagtagacatgaca
gtgatcaacctgactaaccacgcctactggaacctcaacggtgttccgcggccagcagag
gcggatgccgtggcaccgctgccgcgaagcatcacaaaccattacctgcagttgcagtcc
aggtacttcgctgtcaccgatgaatcgagcatcccgaatggcgacatgcgtcctgtcgag
ggtaccctgcacgactactcggagctgcgctgcattgccgaaggaatggaggcgacaaag
gaggagggccgtgacggcggcggctacgacgacccggtcgccctggagacgtgggactcg
actctgcgggaggcagcgctgctgtacagtccagcgacgaagctacgcatgcgggtgtgc
accacgaatccagtcattgtcgtctacacggcgaacgccctgccggccgacgcttctggc
gcaaagggccagcgcttccagcaacacagtgccatctgcttggagtgccagtacttcccg
aacagccccaatgtgccagcgttcccatcgacggcgttgaagaagggcgaggtgtacaag
gagacgacgacgcacgagttccagttcatgaacgcagacatcactccagaggaaaggcag
caacgtcatcactacgctccgtcttag

DBGET integrated database retrieval system