KEGG   Leishmania braziliensis: LBRM_23_0580Help
Entry
LBRM_23_0580      CDS       T01113                                 

Definition
putative acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lbz  Leishmania braziliensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBRM_23_0580
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_23_0580
   00620 Pyruvate metabolism
    LBRM_23_0580
   00640 Propanoate metabolism
    LBRM_23_0580
Enzymes [BR:lbz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LBRM_23_0580
Lipid biosynthesis proteins [BR:lbz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LBRM_23_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23:188440..190566
Genome map
AA seq 708 aa AA seqDB search
MSHNTDSAHAVPSASLDQACNSSSQISAAQHVSNFKSVLDSNIVNPTEANRKKSCIGSEL
DSRMRIYEYSVTQNDAFWAEIARRDFYWKQTWADDHHVKSYNFDKSKGPIFVKWFEGAVT
NVCHNALDRHLPAHRERVCFYFEGNDPSVKETITYGDMYTRVVELANVLRYQYGIEKGDR
VGLYLPMIPCAAVAMLACARIGAVITVVFGGFSAQALSSRLKDSRAKLLITADASSRGTK
LIPLKDVADEALKTLEEKGMPIPCLVAENGNREGCKMKEGRDTWCSDAVARLTPEQHLEC
PVEWMEAEDVLFLLYTSGSTGKPKAIEHTTAGYMVYAATTFKYSFDYHMDDVYFCTADVG
WITGHSYVVYGPMIHCATSVLFEGVPSYPDYSRWWQLIEKYKVSIFYTAPTAIRSLIQAG
DDYPKACDRSTLRVLGSVGEPINVEAWKWLREVGGEGHCDVSDTWWQTETGGHMITPMPG
CTPMKPGSATLPFFGIEPVILDPMKLHEKNGPAEGLLAIRAPWPGMARTIFGDHARFEQT
YFSVDGYYLTGDGARRDADGYYWITGRVDDVLNVSGHRIGTSEVEEAVNAHPAVAESAVV
GFPHKIKGEGIYVYLAFRSGVKATPVLVNEVKATVRKVIGPLATPDVVQVAHLGLPKTRS
GKIVRRILRKVAAGVYTELGDTTTLANPDVIDDLTAEHQRLCPPHEAL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaatacggactccgcgcacgcggtgccgtcggcctcgctggatcaggcgtgc
aactcatccagccagatctccgccgcacaacacgtgagcaacttcaagagtgtgctagac
tcgaacattgtgaacccaacggaggcgaaccgcaaaaaatcgtgcatcggctccgaactt
gattctcgcatgcgcatctacgagtactccgttacgcagaacgacgccttctgggcggaa
attgcgcggcgcgacttctattggaagcagacctgggcggatgaccaccacgtcaagtcg
tacaacttcgacaaatccaagggacccatctttgtgaagtggttcgagggcgccgtgacc
aatgtctgccacaacgcgttggaccgccacctgccagcgcacagggagcgcgtgtgcttt
tactttgaaggcaacgacccaagcgtgaaggagacgattacgtatggcgacatgtacacc
agagtggtagagctggcaaacgtgctgaggtaccagtacggtattgaaaagggcgaccgt
gttggcctgtacctgcccatgatcccgtgcgctgcggtggccatgcttgcctgcgcccgc
atcggcgctgtcataactgtggtcttcggaggcttctccgcacaggcgctcagctcacgt
ctgaaggattctagggcaaagctgcttatcacagctgacgcgtcctctcgcggcacaaag
ttgattcctctcaaggacgtggcagacgaagcgctgaagacgttggaagagaaaggtatg
ccaatcccgtgcctcgtcgctgaaaatggaaaccgtgagggctgcaagatgaaggaaggc
cgcgatacctggtgcagcgacgccgtagcgcggctgacgccggagcagcacctggagtgc
ccggtggagtggatggaggcggaggatgtgctgttcctgctctacacctctggcagcacc
gggaagcccaaggccatcgagcacacgacggcaggctacatggtgtacgccgccaccacc
ttcaagtacagcttcgactaccacatggacgatgtgtacttctgcacggcagacgtgggc
tggatcacaggccacagctacgtcgtgtatggcccgatgatccactgcgccacgtcagtg
ctgttcgagggcgtgcccagctaccccgactactcgcgctggtggcagcttatcgagaag
tacaaggtgtccatcttctacaccgcgccgaccgcgattcgctccctcatacaggccggc
gacgactaccccaaggcgtgcgaccgcagcaccctgcgtgtgcttggctccgtcggtgag
ccgatcaacgtggaggcgtggaagtggctgcgcgaggtcggcggcgagggtcactgcgat
gtgtcggacacgtggtggcagacggagacgggcggtcacatgattacaccgatgccagga
tgcaccccgatgaagcccggtagtgcaacactgccgttcttcggtatcgagccggtcatc
ctcgaccccatgaagctgcatgagaagaacggcccagcggagggcctgcttgccattcgc
gcgccatggcccggtatggctcgcaccatctttggtgaccacgcccgctttgagcaaacc
tacttttctgtagacgggtactatctgacaggcgacggtgctcgccgcgacgcagacggc
tactactggatcactggccgcgtcgatgacgtgctgaacgtgagcgggcaccgcatcggc
accagcgaggtagaagaggccgtcaacgcccacccagctgtggcggaaagcgccgtggtt
ggattccctcacaagatcaagggtgagggcatctacgtgtacctcgcattccgcagcggg
gtaaaggcaacaccggtgctggttaacgaagtgaaggcgacggtgcgcaaggtgatcggt
ccgctggccacgccggacgtggtgcaggtggctcacctcggcctgccaaagacgcgatct
ggcaagattgtgcgcagaatcctgcgcaaggtggctgctggggtgtacacagagctgggc
gacaccacgacgcttgcgaaccctgatgttatcgacgacctcaccgctgagcaccagcga
ctgtgccctcctcacgaggcactgtag

DBGET integrated database retrieval system