KEGG   Leishmania braziliensis: LBRM_23_0800Help
Entry
LBRM_23_0800      CDS       T01113                                 

Definition
putative acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lbz  Leishmania braziliensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lbz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lbz00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lbz00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lbz00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23:complement(293070..295157)
Genome map
AA seq 695 aa AA seqDB search
MSDNIVLSAVMPNSPLSDSQYVRDFKSVLDSKVVEPTEVNSKRSHVGPHLGSRMHIYEYS
VAQNDAFWAEIARRDFYWKQTWADDHHVKSYNFDKSKGPIFVKWFEGAVTNVCHNALDRH
LPAHRERVCFYFEGNDPSVKETITYGDMYTRVVELANVLRYQYGIEKGDRVSLYLPMIPC
AAVAMLACARIGAVASVIFGGFSAQAIVTRVVDCKPKLIITADASSRGAKPILLKAIVDE
ALEDCSVLGCNVPCLVFENVNREGCKMKEGRDTWCSDAVARLTPEQHLECPVEWMEAEDV
LFLLYTSGSTGKPKAIEHTTAGYMVYAATTFKYSFDYHMDDVYFCTADVGWITGHSYVVY
GPMIHCATSVLFEGVPSYPDYSRWWQLIEKYKVSIFYTAPTAIRSLIQAGDNYAKACDRS
TLRVLGSVGEPINVEAWKWLREVGGEGHCDVSDTWWQTETGGHMITPMPGCTPMKPGSAT
LPFFGIEPVILDPMKLHEKNGPADGLLAIRAPWPGMARTIFGDHARFEQTYFSVDGYYLT
GDGARRDADGYYWITGRVDDVLNVSGHRIGTSEIEEAVNTHPAVVESAAVGFPQSIKGEG
IYVFLTFQQGTEVAPELLAAVKATVRKVIGPLATPDVLHPAQEGLPKTRSGKIVRRVLRK
IATHNDDDFGDTSTLADPTVVDALKRSRAKWVDRS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacatcgtcttaagtgcggtgatgccaaacagtccgctgtcagactcccag
tatgtgcgcgacttcaagagtgtgctggactcgaaggttgtggagccgacagaggtgaac
agcaagaggtcgcacgttggcccacacctgggctctcgcatgcacatctacgagtactcc
gttgcacagaacgacgccttctgggcggaaattgcgcggcgcgacttctattggaagcag
acctgggcggatgaccaccacgtcaagtcgtacaacttcgacaaatccaagggacccatc
tttgtgaagtggttcgagggcgccgtgaccaatgtctgccacaacgcgttggaccgccac
ctgccagcgcacagggagcgcgtgtgcttttactttgaaggcaacgacccaagcgtgaag
gagacgattacgtatggcgacatgtacaccagagtggtagagctggcaaacgtgctgagg
taccagtacggtattgaaaagggcgaccgtgtgagcctgtacctgcccatgattccgtgt
gctgcggtggccatgcttgcctgcgcccgcatcggtgcagttgccagcgtaatcttcgga
ggcttctccgcacaggcaatcgtgacacgcgtcgtagactgcaagccgaaacttatcatc
acagctgacgcgtcctctcgcggtgcgaagccgattctgctaaaggcgattgtggatgag
gcgttggaggactgcagtgtcctggggtgcaacgtgccgtgccttgtattcgaaaatgtc
aaccgtgagggctgcaagatgaaggaaggccgcgatacctggtgcagcgacgccgtagcg
cggctgacgccggagcagcacctggagtgcccggtggagtggatggaggcggaggatgtg
ctgttcctgctctacacctctggcagcaccgggaagcccaaggccatcgagcacacgacg
gcaggctacatggtgtacgccgccaccaccttcaagtacagcttcgactaccacatggac
gatgtgtacttctgcacggcagacgtgggctggatcacaggccacagctacgtcgtgtat
ggcccgatgatccactgcgccacgtcagtgctgttcgagggcgtgcccagctaccccgac
tactcgcgctggtggcagcttatcgagaagtacaaggtgtccatcttctacaccgcgccg
accgcgattcgctccctcatacaggccggcgacaactacgccaaggcgtgcgaccgcagc
accctgcgtgtgcttggctccgtcggtgagccgatcaacgtggaggcgtggaagtggctg
cgcgaggtcggcggcgagggtcactgcgatgtgtcggacacgtggtggcagacggagacg
ggcggtcacatgattacaccgatgccaggatgcaccccgatgaagcccggtagtgcaaca
ctgccgttcttcggtatcgagccggtcatcctcgaccccatgaagctgcatgagaagaac
ggcccagcagatggcctgcttgccattcgcgcgccatggcccggtatggctcgcaccatc
tttggtgaccacgcccgctttgagcaaacctacttttctgtagacgggtactatctgaca
ggcgacggtgctcgccgcgacgcagacggctactactggatcactggccgcgtcgatgac
gtgctgaacgtgagcgggcaccgcatcggcaccagcgagatagaagaggccgtcaacacc
cacccggctgtggtggagagcgccgcggttggatttcctcaaagcatcaagggtgaggga
atctacgtcttccttacgtttcaacaggggacggaggtggctcccgagctgctggcggca
gtgaaggcgacggtgcgcaaggtgatcggtccgctggccacgccggacgtgctgcacccc
gcgcaagagggtctgccaaagacgcgatctggaaaaattgtgcgccgtgtgctgcgtaaa
attgccacacacaacgacgacgactttggtgacacctcgaccctggcggatcccaccgtt
gtggatgcattgaagcgctcgcgcgcgaagtgggtggatcgcagctag

DBGET integrated database retrieval system