KEGG   Leishmania braziliensis: LBRM_23_0990Help
Entry
LBRM_23_0990      CDS       T01113                                 

Definition
(RefSeq) beta-fructosidase-like protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00052  Galactose metabolism
lbz00500  Starch and sucrose metabolism
lbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBRM_23_0990
   00500 Starch and sucrose metabolism
    LBRM_23_0990
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LBRM_23_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 5415745
NCBI-ProteinID: XP_001565171
UniProt: A4HCW0
Position
23:complement(392913..394295)
Genome map
AA seq 460 aa AA seqDB search
MNNPTGLVYFRGSYHVFYQYHPYSSTWGPMHWGHFTSEDLVHWKREKTALAPGDACDRDG
CFSGSAIVHEDKMYIVYTGNFALDKAMPNKPDAIYEQQCVAVSSDGVNFEKLGVVVRPPP
GYVHFRDPKVWQQDGRWWMVCGARDVTKDLGQLLLFTTQDLLCWDDTNWQVLGMTEDKNV
FMWECPDFFTIGNHQDMKLLLFCPQGKKASKYNYRNRFQNGYTIGQWMPGMPWTVQQEFR
ELDRGHDFYAPQTFLAADSERRLVIAWCNMWESPMPTREHGWSGCLTLPRELRYNAATGQ
LQMLPAQELVGLRTSEGTTLPHLLVGSNNDALIIEECTAYELDIAFNTETSTAEKYGLWL
GSGAELYVDAQSKRLVLNRHYPQYMLSGYRSCEMPAGVLLQLHVFIDRSSIEVFVNNGEV
TFSSRVFPEEGDRALRVFSVNGVADMAGGTMWKLETTVKH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacccgacggggctggtctactttcgtggcagctatcacgtcttctaccagtat
cacccctacagctccacgtggggcccaatgcactggggccacttcacaagcgaggacctc
gtgcactggaagcgcgaaaagactgccctggcgccaggcgacgcgtgcgatcgcgacgga
tgcttctctggcagcgccatcgtacacgaagataaaatgtacattgtctacacggggaac
tttgcacttgacaaggcgatgccaaacaaaccggatgctatctatgagcagcagtgcgtc
gctgtcagcagcgatggcgtgaactttgagaagctcggcgttgtcgtgcgcccgccaccg
gggtacgtgcacttccgtgacccgaaggtgtggcagcaggacgggcggtggtggatggtg
tgcggtgcccgagacgtgacgaaggaccttggccagctgcttctcttcaccacgcaggac
ctcctttgctgggacgacacgaactggcaggtgctagggatgacggaggacaagaacgtg
ttcatgtgggagtgccccgacttctttacgatcggaaatcaccaggatatgaagctactg
ctattttgtcctcaaggaaagaaggccagcaagtacaactaccgcaatcgcttccagaat
gggtataccatcgggcaatggatgcctggaatgccgtggacggtgcagcaggagttccgt
gagcttgacagaggccatgacttctacgcgccgcagacgttcctcgccgccgatagcgag
aggcgtctggtgattgcgtggtgcaacatgtgggagagccccatgccgacgcgcgagcac
ggttggagcggctgcttgacactgccgcgagagctacgctacaacgcggcaacaggacag
ctccaaatgctgccagcgcaggagctggtcggcctgcgtacatcggaggggacaactctg
cctcatcttcttgtaggaagcaacaacgatgcgctcattatcgaggaatgcactgcctac
gagctagatatcgccttcaacacggagacgagcacggcggagaagtacgggctgtggctc
ggctcgggggcggagctgtacgtggacgcgcagtcgaagcggctggtgctgaaccgccac
tacccgcagtacatgctgagcgggtatcgctcctgcgagatgccggcaggtgtgcttctg
cagctgcacgtgttcattgaccgctcgtcgattgaggtgttcgtgaacaacggcgaggtc
actttctcttcccgcgtcttccccgaggagggcgaccgggcactgcgcgtcttctcggtg
aacggggttgcggacatggcgggcggtaccatgtggaagctcgagacgacggtgaagcac
tga

DBGET integrated database retrieval system