KEGG   Leishmania braziliensis: LBRM_24_0010Help
Entry
LBRM_24_0010      CDS       T01113                                 

Definition
putative pyruvate dehydrogenase (lipoamide) kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     LBRM_24_0010
Protein kinases [BR:lbz01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   LBRM_24_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24:3455..4810
Genome map
AA seq 451 aa AA seqDB search
MLRRGVCRSIPLLGPTFTELVERLDSFEKEFIEWKAFRKAVESTSPKVTEAAKQIMAESM
KEVKTTKVNLDNPLTPEEFTELNQFYAKQKMKDIVFENLLYINTPNDLMQHAETVFRQYL
VRIARRVRHLSHAPYGLSQMPGIQKLKKWYQWSFHDVRSTPVPTCRDGCYRCDRMVRRVF
LRHYNVSSLITDGMIEFAKREGWVNVDEEVIRTYDELQHFFEDFCLGRVRLRFLVGNYMY
LSTKILGVSREESAVNDPEGLTVPIFLDHNPEDFVGQICKKCSLLVLTKCAIKVAQATYD
AEIELKVAGVPDLVFVGVPCITYDIICAMLEDAVCANINRQERTGKPCTKIEVTLAQWPT
SKRFVLRVSDTAGGMTLRQASMQLSCWSLYGNIQSHNQDSISTWTSSPIRLPYAYNAARV
IGGNITLASIEGYGTDRQLYLPSTGLAGVSL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtcgaggcgtttgccggagtatcccactcttgggacccacgtttaccgagctc
gtggagcgtctggactcgtttgaaaaggagtttattgaatggaaggcgtttcgcaaagcg
gtggagtcaacgtcgccgaaagtaactgaggcggcgaaacagattatggcggagagtatg
aaggaggtaaaaacgactaaggtgaacttggataacccgttgacgcctgaggagttcacg
gagttgaatcagttctatgccaagcagaagatgaaggatatagttttcgagaacttactg
tacatcaacactccgaatgatctgatgcagcatgcggagactgtttttcgacagtacctt
gtgcgcattgcccgtcgggtgcgacacttgagccatgcaccgtatggcctctcacaaatg
ccgggaattcaaaagctgaagaagtggtaccagtggagttttcatgatgtccgcagcact
ccagtgccgacgtgccgggacgggtgctatcggtgcgaccgcatggtgcggcgcgttttt
ctgcgacactacaatgtcagctcactcattaccgatggaatgatcgagtttgctaagcgc
gaggggtgggtaaatgtagacgaagaagtgatacgcacatatgatgagctgcagcacttc
ttcgaagatttttgcctgggtcgcgtccgtcttcgctttttggtcggcaattacatgtat
ctttcgacaaaaattctgggtgtatcacgagaggaaagcgctgtgaatgatcctgagggg
ctcacagttcctatcttcttggaccacaatccggaggattttgtagggcagatctgcaag
aaatgctcgctgttggtgctcacaaagtgcgcaatcaaggtagcccaggcaacctacgat
gcggagattgagctgaaggtggctggcgtccctgatttggtgtttgttggggtgccatgt
atcacatacgacattatttgtgcaatgctggaggatgctgtctgtgcaaatataaatcgc
caggagcggacaggcaaaccgtgcacaaaaattgaagtcacgcttgcgcagtggccgaca
agcaagcgttttgtactgcgtgtatctgacacggcgggtggaatgacattgcgccaggct
tcgatgcagctgtcctgctggtctctctacggaaatatccagagccataatcaggattcg
atctcgacgtggacctcgagtccgattcggctaccttatgcgtacaacgccgcacgcgtt
attggtgggaacatcacactggcatccattgaaggctacgggactgatcggcagctatac
ctaccgtctaccgggcttgctggtgtgtcgctgtga

DBGET integrated database retrieval system