KEGG   Leishmania braziliensis: LBRM_24_0420Help
Entry
LBRM_24_0420      CDS       T01113                                 

Definition
putative ubiquitin carboxyl-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LBRM_24_0420
Peptidases [BR:lbz01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LBRM_24_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24:139334..140257
Genome map
AA seq 307 aa AA seqDB search
MPSDESRWCLIESDPAVFREIVQTVGVKGVSVEDLIMLDPSILEQYEDVYSLVLLFKWQS
SEQASLLGTVVKDAPVFFAKQVIHNACATLAIMNTLCNYSDQVDLGPKVQNYLSFCQDLD
PEMRGSLLDSFDELREAHNSFAPRSAFEKDEPSQKNADVYHFVSFVYRHGHIWELDGLQE
GPLQCREATDANYREALVEVVQRRIDDIAAKDTTGAGQGISFSLMTIVADPVTVLERNIA
ALRAEEKPTTALDEELAEMLLLRKKDKEANARRRHDYNAMIVTLLKSLAERGKLEKIVAE
VQAKVSK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgatgagagccgctggtgtttgatcgagagcgacccggcagtgttcagggag
atcgttcaaaccgtcggcgtgaagggggtctctgtggaggacctcattatgctcgacccc
tcgattctagagcagtacgaggacgtatacagtcttgtgttgttgttcaagtggcagtca
tcggagcaggcgtcgctgctgggcaccgtcgtgaaggacgcgccggtgttctttgccaag
caagtgattcacaacgcctgtgccacgcttgccatcatgaacacgctgtgcaactactcg
gatcaggtggatctgggaccgaaagtgcagaactacctgagcttctgccaagacctcgac
cctgagatgcgcggctcgctcctggacagcttcgacgagctgcgcgaggcccataactcc
ttcgcgccacgctcggcgtttgagaaagatgagccgtcgcagaagaacgcggatgtctat
cactttgtctcctttgtgtaccgccacggacacatctgggagctggatgggctgcaggag
ggcccgctgcagtgccgggaggcgaccgacgcgaactaccgagaggcactcgttgaggta
gtgcagcggcgcatcgacgacattgcggcgaaggatacgacgggcgccggacagggtatc
tccttctcgctcatgacgattgtcgctgaccccgttacggtgttggaaaggaacattgcg
gctctcagagcggaagaaaagcccacgacggcgctggacgaagaactggctgagatgttg
ttactgcgcaagaaagacaaggaggcaaacgcgcgtcgccgtcacgactacaatgctatg
atcgtgacgctgctgaagtccctggcggagcgcggcaagctggagaagatcgtggcggag
gtgcaggcgaaggtctccaaataa

DBGET integrated database retrieval system