KEGG   Leishmania braziliensis: LBRM_24_1510Help
Entry
LBRM_24_1510      CDS       T01113                                 

Definition
putative histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lbz  Leishmania braziliensis
Brite
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LBRM_24_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24:complement(535809..537110)
Genome map
AA seq 433 aa AA seqDB search
MRPSRVRALHALVHSLGLDDAECMTVCHARPATAEEMGTFHRGAYLECLRQAPVICGNPL
DEMSLAFQKEFDVPFASQEGDCPLFPEVWSLVSSQAGASLACAEALLRGDATVAMNWAGG
MHHAAAAHASGFCFVNDIVLCIRRLLRHYQRVLYIDLDVHHGDGVEGAFYGNHRVMTLSL
HQFGNGFFPGTGDYPTRETADSFAINVPLPTRTGDAAYLLSFRTALSSVVQCFDPEAMVV
QCGADTIVGDLIGRLCVTTLAHTQCVANVLSFERPTVLLGGGGYHVFHTARCWAIHTATA
LGRTAAQLPLYIPRTDPYYMDYRQECTPKRPTLHVFLDPDVDDPLPLGDSLVFWRQLCLS
IQWQMRTARLVRQGFSRTVQLCRQRRAALLRQFASQEAGKESGVGVSGPKRPRSAATTDR
SGEEGAEDRVFSG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgtctcgcgtgcgtgcgctgcacgcgcttgttcattccttgggcctcgacgat
gcagagtgtatgacggtgtgccatgctcgtccggcaacggcagaggagatggggacgttt
caccgcggcgcatacttggagtgtctgcggcaggcgccggtcatttgcgggaatccgctg
gacgagatgtccctcgcctttcagaaggaatttgacgtcccgttcgcgtctcaggagggc
gactgtcctctcttcccggaggtatggtcactggtgtccagccaagctggtgcctcgctt
gcctgtgcagaggccctcttgcgcggcgatgctacagtggcgatgaactgggccggtggc
atgcatcacgccgctgctgcccacgcaagcgggttctgctttgtgaatgacattgtgctg
tgcatccgccggcttctgcggcactaccagcgcgttctttacattgacctggatgtgcat
cacggggacggcgtggagggggccttttatggcaatcaccgcgtgatgacactctcgctt
caccagttcggcaacggctttttccccggcaccggcgactacccaacacgtgagacagct
gacagcttcgctatcaacgtcccactacccacgcggacgggagacgccgcttacctctta
tctttccgcactgcactgtccagcgtggttcagtgtttcgatccggaggcgatggtcgtg
cagtgcggcgccgacaccatagtaggcgacctcattgggcgactttgcgtgactacgttg
gcgcacacgcagtgtgtggccaatgtgctgtcatttgagcgaccgacggtactgcttgga
ggaggcggttaccacgtgtttcacacggcccgctgctgggcgatccacaccgccaccgcg
cttggtcgcacagccgcacagctacccttgtacatcccgcgcacggacccctactacatg
gattaccggcaagaatgcacgccaaagcggccgacgctgcacgtatttctcgaccctgac
gttgatgacccactgccgctgggggacagcttggtgttctggcgtcaactgtgtctcagc
atccagtggcagatgcgcactgcccgccttgtgaggcaagggttttctcgcacagtacag
ctttgccggcagagacgggcagcgttgctgaggcagttcgcctcgcaagaggcagggaaa
gaatctggtgtcggtgttagcggtcctaagcgcccccgctcagcagctacaacggaccgc
agtggcgaggagggggcggaggacagagtgttctcggggtga

DBGET integrated database retrieval system